E.coli Recombinant

Recombinant Rotavirus A Outer capsid glycoprotein VP7 | CSB-EP318053ROH | CusabioAlternative Name(s): ; Outer capsid glycoprotein VP7Gene Names: N/AResearch Areas: OthersOrganism: Rotavirus A (strain Human/United Kingdom/ST3/1975...

Recombinant Human herpesvirus 1 Envelope glycoprotein C (gC), partial | CSB-EP318025HWY1 | CusabioAlternative Name(s): /Gene Names: gCResearch Areas: ImmunologyOrganism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)AA Sequence:...

Recombinant Human herpesvirus 1 Envelope glycoprotein B (gB), partial | CSB-EP318023HWY | CusabioAlternative Name(s): gB; UL27Envelope glycoprotein B; gBGene Names: gBResearch Areas: OthersOrganism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes...

Recombinant Chicken Ovoinhibitor (OIH), partial | CSB-EP318020CH | CusabioAlternative Name(s): OIH; OvoinhibitorGene Names: OIHResearch Areas: OthersOrganism: Gallus gallus (Chicken)AA Sequence:...

Recombinant Saccharomyces cerevisiae Copper metallothionein 1-1 (CUP1-1) | CSB-EP317846SVGe0 | CusabioAlternative Name(s): Copper chelatin ?Copper thionein?Gene Names: CUP1-1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 /...

Recombinant Saccharomyces cerevisiae Copper metallothionein 1-1 (CUP1-1) | CSB-EP317846SVG | CusabioAlternative Name(s): Copper chelatin (Copper thionein) (Cu-MT) (Cu-metallothionein) (MTH1)Gene Names: CUP1-1Research Areas: Signal TransductionOrganism:...

Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1) | CSB-EP317825EFC | CusabioAlternative Name(s): 33 kDa early protein p33Gene Names: BARF1Research Areas: CancerOrganism: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)AA...

Recombinant Loxosceles intermedia Phospholipase D LiSicTox-alphaIA1a | CSB-EP317615LRA | CusabioAlternative Name(s): Dermonecrotic toxin 1 (LiRecDT1) (Sphingomyelin phosphodiesterase D 1) (SMD 1) (SMase D 1) (Sphingomyelinase D 1) (PLD)Gene Names:...

Recombinant Escherichia coli Transposase insE for insertion sequence IS3A (insE1) | CSB-EP317177ENV | CusabioAlternative Name(s): insE1; b0298; JW5036; Transposase InsE for insertion sequence IS3AGene Names: insE1Research Areas: OthersOrganism:...

Recombinant Dermatophagoides pteronyssinus Major mite allergen Der p 23 | CSB-EP3170DJH | CusabioAlternative Name(s): Major house dust mite allergen Der p 23 ?Major HDM allergen Der p 23? (Peritrophin-like protein Der p 23) Gene Names: N/AResearch Areas:...

Recombinant Escherichia coli CFA/I fimbrial subunit B (cfaB) | CSB-EP316797ENL | CusabioAlternative Name(s): CFA/I antigen (CFA/I pilin) (Colonization factor antigen I subunit B) (cfaB)Gene Names: cfaBResearch Areas: ImmunologyOrganism: Escherichia...

Recombinant Cyriopagopus schmidti Tau-theraphotoxin-Hs1a | CSB-EP316743DRU | CusabioAlternative Name(s): Double-knot toxin (DkTx) (Tau-TRTX-Hs1a)Gene Names: N/AResearch Areas: OthersOrganism: Cyriopagopus schmidti (Chinese bird spider) (Haplopelma...

Recombinant Conus striatus Con-ikot-ikot | CSB-EP316701DWI | CusabioAlternative Name(s): Con-ikot-ikotGene Names: N/AResearch Areas: OthersOrganism: Conus striatus (Striated cone)AA Sequence:...

Recombinant Dahlia merckii Defensin-like protein 1 | CSB-EP316614DAE | CusabioAlternative Name(s): Cysteine-rich antimicrobial protein 1 Defensin AMP1Gene Names: N/AResearch Areas: OthersOrganism: Dahlia merckii (Bedding dahlia)AA Sequence:...

Recombinant Chlamydia trachomatis Virulence plasmid protein pGP3-D | CSB-EP316550DSA | CusabioAlternative Name(s): Proteins P-6/P-7Gene Names: N/AResearch Areas: OthersOrganism: Chlamydia trachomatisAA Sequence:...

Recombinant Neosartorya fumigata 1, 3-beta-glucanosyltransferase gel4 (gel4) | CSB-EP316454NGS | CusabioAlternative Name(s): Glucan elongating glucanosyltransferase 4Gene Names: gel4Research Areas: OthersOrganism: Neosartorya fumigata (strain ATCC...

Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA) | CSB-EP316432DSB | CusabioAlternative Name(s): 9KDA cysteine-rich lipoprotein Short name:9KDA-CRPGene Names: omcAResearch Areas: MicrobiologyOrganism: Chlamydia...

Recombinant Candida albicans Candidapepsin-2 (SAP2) | CSB-EP316205CZF | CusabioAlternative Name(s): ACP 2 Aspartate protease 2 Secreted aspartic protease 2Gene Names: SAP2Research Areas: OthersOrganism: Candida albicans (Yeast)AA Sequence:...

Recombinant Aspergillus clavatus Ribonuclease clavin (cla) | CSB-EP316109AVC | CusabioAlternative Name(s): /Gene Names: claResearch Areas: TranscriptionOrganism: Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)AA...

Recombinant Salmonella typhimurium Invasion protein iagB (iagB) | CSB-EP315647SXB | CusabioAlternative Name(s): iagB; STM2877Invasion protein IagBGene Names: iagBResearch Areas: OthersOrganism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC...

Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB) | CSB-EP315643ENL | CusabioAlternative Name(s): LT-B, human;LTH-BGene Names: eltBResearch Areas: OthersOrganism: Escherichia coliAA Sequence:...

Recombinant Mycoplasma pneumoniae Proline-rich P65 protein (p65) | CSB-EP315626MLW | CusabioAlternative Name(s): Gene Names: p65Research Areas: Signal TransductionOrganism: Mycoplasma pneumoniae (strain ATCC 29342 / M129)AA Sequence:...

Recombinant Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA (aiiA) | CSB-EP315623BDC | CusabioAlternative Name(s): AHL-lactonase AiiAGene Names: aiiAResearch Areas: OthersOrganism: Bacillus thuringiensis subsp. KurstakiAA...

Recombinant Chlamydia trachomatis Large cysteine-rich periplasmic protein OmcB (omcB), partial | CSB-EP315528DSB | CusabioAlternative Name(s): Large-CRP Alternative name(s): 60KDA cysteine-rich OMP 60KDA outer membrane protein Cysteine-rich outer...

Recombinant Ornithorhynchus anatinus Defensin-A1 | CSB-EP315251OEX | CusabioAlternative Name(s): DefA1 (OaDefA1)Gene Names: N/AResearch Areas: OthersOrganism: Ornithorhynchus anatinus(Duckbill platypus)AA Sequence: DTTFCRCRVSCNILEKYSGKCELSGRTARICCSource:...

Recombinant Horse Myelin P2 protein (PMP2) | CSB-EP315130HO | CusabioAlternative Name(s): PMP2; Myelin P2 proteinGene Names: PMP2Research Areas: OthersOrganism: Equus caballus (Horse)AA Sequence:...

Recombinant Conus vexillum Alpha-conotoxin VxXXC | CSB-EP314942DWK | CusabioAlternative Name(s): VxXIICGene Names: N/AResearch Areas: OthersOrganism: Conus vexillum (Flag cone)AA Sequence: DLRQCTRNAPGSTWGRCCLNPMCGNFCCPRSGCTCAYNWRRGIYCSCSource: E.coliTag...

Recombinant Streptococcus pyogenes Streptopain (speB) | CSB-EP314886SMR | CusabioAlternative Name(s): Exotoxin type B SPE B Streptococcal cysteine proteinase Streptococcus peptidase A Short name: SPPGene Names: speBResearch Areas: MicrobiologyOrganism:...

Recombinant Escherichia coli Thioredoxin-2 (trxC) | CSB-EP314858ENV | CusabioAlternative Name(s): Protein-disulfide reductaseGene Names: trxCResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Clostridium perfringens Perfringolysin O (pfo) | CSB-EP314820CMB | CusabioAlternative Name(s): Theta-toxin Thiol-activated cytolysinGene Names: pfoResearch Areas: MicrobiologyOrganism: Clostridium perfringens (strain 13 / Type A)AA Sequence:...

Recombinant Human immunodeficiency virus type 1 group M subtype K Protein Vpr (vpr) | CSB-EP314796HLP | CusabioAlternative Name(s): R ORF protein (Viral protein R)Gene Names: vprResearch Areas: ImmunologyOrganism: Human immunodeficiency virus type 1...

Recombinant Chlamydia trachomatis 60KDA chaperonin (groL) | CSB-EP314770DSB | CusabioAlternative Name(s): 57KDA chlamydial hypersensitivity antigen GroEL protein Heat shock protein 60 HSP60 Protein Cpn60Gene Names: groLResearch Areas:...

Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial | CSB-EP314743ESE | CusabioAlternative Name(s): lktA; Leukotoxin; LktGene Names: lktAResearch Areas: OthersOrganism: Mannheimia haemolytica (Pasteurella haemolytica)AA Sequence:...

Recombinant Escherichia coli Antitoxin RelB (relB) | CSB-EP314742ENV | CusabioAlternative Name(s): relB; b1564; JW1556; Antitoxin RelBGene Names: relBResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin (ply) | CSB-EP314690FMWg2 | CusabioAlternative Name(s): Thiol-activated cytolysinGene Names: plyResearch Areas: OthersOrganism: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 /...

Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin (ply), Biotinylated | CSB-EP314690FMWg10-B | CusabioAlternative Name(s): Thiol-activated cytolysinGene Names: plyResearch Areas: OthersOrganism: Streptococcus pneumoniae serotype 4 (strain ATCC...

Recombinant Streptococcus pneumoniae serotype 4 Pneumolysin (ply) | CSB-EP314690FMW | CusabioAlternative Name(s): Thiol-activated cytolysinGene Names: plyResearch Areas: OthersOrganism: Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)AA...

Recombinant Clostridium perfringens Phospholipase C (plc) | CSB-EP314672CMB | CusabioAlternative Name(s): Alpha-toxin (Hemolysin) (Lecithinase) (Phosphatidylcholine cholinephosphohydrolase)Gene Names: plcResearch Areas: Signal TransductionOrganism:...

Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP) | CSB-EP314631ENV | CusabioAlternative Name(s): Heat shock protein DegPProtease DoGene Names: degPResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Mycoplasma hyopneumoniae 46KDA surface antigen (p46) | CSB-EP314621MLQ | CusabioAlternative Name(s): p46Gene Names: p46Research Areas: OthersOrganism: Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110)AA Sequence:...

Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 4 peptide (psmA4) | CSB-EP314541SUK | CusabioAlternative Name(s): /Gene Names: psmA4Research Areas: Cell BiologyOrganism: Staphylococcus aureus (strain Mu3 / ATCC 700698)AA Sequence:...

Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 3 peptide (psmA3) | CSB-EP314539SKX | CusabioAlternative Name(s): /Gene Names: psmA3Research Areas: Cell BiologyOrganism: Staphylococcus aureus (strain Mu50 / ATCC 700699)AA Sequence:...

Recombinant Epstein-Barr virus Apoptosis regulator BHRF1 (BHRF1), partial | CSB-EP314488EFC | CusabioAlternative Name(s): Early antigen protein RGene Names: BHRF1Research Areas: OthersOrganism: Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus...

Recombinant Culex quinquefasciatus Odorant binding protein OBP28 (6050687) | CSB-EP3143DZM | CusabioAlternative Name(s): /Gene Names: 6050687Research Areas: OthersOrganism: Culex quinquefasciatus (Southern house mosquito) (Culex pungens)AA Sequence:...

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) | CSB-EP314366MVZa0 | CusabioAlternative Name(s): 30KDA extracellular protein Acyl-CoA:diacylglycerol acyltransferase Antigen 85 complex BGene Names:...

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB) | CSB-EP314366MVZ | CusabioAlternative Name(s): 30KDA Extracellular domain protein;Acyl-CoA:diacylglycerol acyltransferaseAntigen 85 complex B ;85B...

Recombinant Bitis gabonica Thrombin-like enzyme gabonase, partial | CSB-EP314359BGW | CusabioAlternative Name(s): Fibrinogen-clotting enzyme Snake venom serine proteaseGene Names: N/AResearch Areas: OthersOrganism: Bitis gabonica (Gaboon adder) (Gaboon...

Recombinant Mycobacterium smegmatis DNA protection during starvation protein (dps) | CSB-EP314354MVW | CusabioAlternative Name(s): dpsDNA protection during starvation protein; EC 1.16.-.-Gene Names: dpsResearch Areas: MicrobiologyOrganism: Mycobacterium...

Recombinant Vesicular stomatitis Indiana virus Glycoprotein G (G), partial | CSB-EP314306VBH | CusabioAlternative Name(s): G; Glycoprotein G; FragmentGene Names: GResearch Areas: Signal TransductionOrganism: Vesicular stomatitis Indiana virus (strain...

Recombinant Dendroaspis angusticeps Fasciculin-2 (Fas-2) | CSB-EP314272DBG | CusabioAlternative Name(s): Short name:Fas-2 Short name:Fas2 Alternative name(s): Acetylcholinesterase toxin F-VII Fasciculin-II Short name:FAS-II Toxin TA1Gene Names:...

Recombinant Staphylococcus aureus Phenol-soluble modulin alpha 1 peptide (psmA1) | CSB-EP314123FLF | CusabioAlternative Name(s): psmA1;SAOUHSC_00411.4Gene Names: psmA1Research Areas: Cell BiologyOrganism: Staphylococcus aureus (strain NCTC 8325 / PS...

Recombinant Zaire ebolavirus Super small secreted glycoprotein (GP) | CSB-EP314099ZAT | CusabioAlternative Name(s): GP; Super small secreted glycoprotein; SsGPGene Names: GPResearch Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV)...

Recombinant Epstein-Barr virus Secreted protein BARF1 (BARF1) | CSB-EP314065EEZ | CusabioAlternative Name(s): Secreted protein BARF1(33 kDa early protein)(p33)Gene Names: BARF1Research Areas: CancerOrganism: Epstein-Barr virus (strain AG876) (HHV-4)...

Recombinant Staphylococcus epidermidis Extracellular elastase (sepA) | CSB-EP313815SLD | CusabioAlternative Name(s): SEPP1Gene Names: sepAResearch Areas: OthersOrganism: Staphylococcus epidermidis (strain ATCC 12228)AA Sequence:...

Recombinant Mycoplasma hyopneumoniae 46 kDa surface antigen (p46) | CSB-EP313811MWKa2 | CusabioAlternative Name(s): p46Gene Names: p46Research Areas: OthersOrganism: Mycoplasma hyopneumoniae (strain 232)AA Sequence:...

Recombinant Mycoplasma hyopneumoniae 46 kDa surface antigen (p46) | CSB-EP313811MWK | CusabioAlternative Name(s): p46Gene Names: p46Research Areas: OthersOrganism: Mycoplasma hyopneumoniae (strain 232)AA Sequence:...

Recombinant Escherichia coli RNA polymerase sigma factor RpoH (rpoH) | CSB-EP313777ENV | CusabioAlternative Name(s): Heat shock regulatory protein F33.4 (RNA polymerase sigma-32 factor) (fam) (hin) (htpR)Gene Names: rpoHResearch Areas: OthersOrganism:...

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein B (isdB), partial | CSB-EP313758SUM | CusabioAlternative Name(s): Fur-regulated protein B Staphylococcal iron-regulated protein H Staphylococcus aureus surface protein JGene...

Recombinant Human T-cell leukemia virus 1 HTLV-1 basic zipper factor (HBZ) | CSB-EP313738HQJ | CusabioAlternative Name(s): HBZHTLV-1 basic zipper factor; HBZGene Names: HBZResearch Areas: CardiovascularOrganism: Human T-cell leukemia virus 1 (strain...

Recombinant Epstein-Barr virus Glycoprotein 42 (BZLF2), partial | CSB-EP313729EFC | CusabioAlternative Name(s): Gene Names: BZLF2Research Areas: OthersOrganism: Epstein-Barr virus (strain GD1) (HHV-4) (Human herpesvirus 4)AA Sequence:...

Recombinant Mannheimia haemolytica Leukotoxin (lktA), partial | CSB-EP313455ESE | CusabioAlternative Name(s): LktGene Names: lktAResearch Areas: CancerOrganism: Mannheimia haemolytica (Pasteurella haemolytica)AA Sequence:...

Recombinant Human Complement C4-B (C4B), partial | CSB-EP313364HU | CusabioAlternative Name(s): Basic complement C4C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3Gene Names: C4BResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA...

Recombinant Escherichia coli 50S ribosomal protein L30 (rpmD) | CSB-EP313324ENVe0 | CusabioAlternative Name(s): rpmD; b3302; JW3264; 50S ribosomal protein L30; Large ribosomal subunit protein uL30Gene Names: rpmDResearch Areas: OthersOrganism:...

Recombinant Escherichia coli 50S ribosomal protein L30 (rpmD) | CSB-EP313324ENV | CusabioAlternative Name(s): rpmD; b3302; JW3264; 50S ribosomal protein L30; Large ribosomal subunit protein uL30Gene Names: rpmDResearch Areas: OthersOrganism: Escherichia...

Recombinant Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase | CSB-EP313316EEA | CusabioAlternative Name(s): ; Beta-glucosyl-HMC-alpha-glucosyl-transferase; EC 2.4.1.-Gene Names: N/AResearch Areas: OthersOrganism: Enterobacteria phage...

Recombinant Human 2-5A-dependent ribonuclease (RNASEL) | CSB-EP313223HUe0 | CusabioAlternative Name(s): 2-5A-dependent ribonuclease(2-5A-dependent RNase)(EC 3.1.26.-)(Ribonuclease 4)(Ribonuclease L)(RNase L)Gene Names: RNASELResearch Areas: Epigenetics...

Recombinant Human 2-5A-dependent ribonuclease (RNASEL), partial | CSB-EP313223HU1 | CusabioAlternative Name(s): Ribonuclease 4Ribonuclease L ;RNase LGene Names: RNASELResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA...

Recombinant Human 2-5A-dependent ribonuclease (RNASEL) | CSB-EP313223HU | CusabioAlternative Name(s): Ribonuclease 4 (Ribonuclease L) (RNase L)Gene Names: RNASELResearch Areas: OthersOrganism: Homo sapiens(Human)AA Sequence:...

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial | CSB-EP313164ZABb1 | CusabioAlternative Name(s): Large structural protein Replicase TranscriptaseGene Names: LResearch Areas: OthersOrganism: Zaire ebolavirus (strain Mayinga-76)...

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial | CSB-EP313164ZAB | CusabioAlternative Name(s): Large structural protein Replicase TranscriptaseGene Names: LResearch Areas: OthersOrganism: Zaire ebolavirus (strain Mayinga-76)...

Recombinant Pseudomonas putida Phthalate 4, 5-dioxygenase oxygenase subunit (pht3) | CSB-EP313137FFZ | CusabioAlternative Name(s): /Gene Names: pht3Research Areas: othersOrganism: Pseudomonas putida (Arthrobacter siderocapsulatus)AA Sequence:...

Recombinant Pseudomonas aeruginosa PA-I galactophilic lectin (lecA) | CSB-EP313124EZX | CusabioAlternative Name(s): Galactose-binding lectinGene Names: lecAResearch Areas: OthersOrganism: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 /...

Recombinant Phanerochaete chrysosporium Cellobiose dehydrogenase (CDH-1) , partial | CSB-EP312474EUK | CusabioAlternative Name(s): Cellobiose-quinone oxidoreductaseGene Names: CDH-1Research Areas: Signal TransductionOrganism: Phanerochaete chrysosporium...

Recombinant Bovine viral diarrhea virus Genome polyprotein, partial | CSB-EP312464BKX1 | CusabioAlternative Name(s): Genome polyprotein [Cleaved into: N-terminal protease; N-pro; EC 3.4.22.-; Autoprotease p20); Capsid protein C; E(rns) glycoprotein;...

Recombinant Yersinia enterocolitica Yop proteins translocation protein M (yscM) | CSB-EP312449YAQ | CusabioAlternative Name(s): yscM; Yop proteins translocation protein MGene Names: yscMResearch Areas: OthersOrganism: Yersinia enterocoliticaAA Sequence:...

Recombinant Vaccinia virus Protein B5 (PS/HR), partial | CSB-EP312446VAI | CusabioAlternative Name(s): Protein B5Gene Names: PS/HRResearch Areas: OthersOrganism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))AA Sequence:...

Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2 (DERF2) | CSB-EP312422DCO | CusabioAlternative Name(s): Allergen Der f II Allergen: Der f 2Gene Names: DERF2Research Areas: OthersOrganism: Dermatophagoides farinae (American house dust...

Recombinant Gossypium hirsutum homeobox protein knotted-1-like 6 (LOC107939280) | CSB-EP3121GHB | CusabioAlternative Name(s): Gene Names: LOC107939280Research Areas: OthersOrganism: Gossypium hirsutum (Upland cotton) (Gossypium mexicanum)AA Sequence:...

Recombinant Streptococcus pneumoniae serotype 2 Pneumolysin (ply) | CSB-EP312102FNF | CusabioAlternative Name(s): Thiol-activated cytolysinGene Names: plyResearch Areas: OthersOrganism: Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)AA...

Recombinant Saccharomyces cerevisiae Ubiquitin-like-specific protease 1 (ULP1), partial | CSB-EP311619SVG | CusabioAlternative Name(s): ULP1; YPL020C; LPB11C; Ubiquitin-like-specific protease 1; EC 3.4.22.68Gene Names: ULP1Research Areas: OthersOrganism:...

Recombinant Enterovirus A71 Genome polyprotein, partial | CSB-EP3114GLAe1 | CusabioAlternative Name(s): Genome polyprotein [Cleaved into: P3; Protein 3AB; P2; P1; Capsid protein VP0(VP4-VP2); Capsid protein VP4(P1A)(Virion protein 4); Capsid protein...

Recombinant Enterovirus A71 Genome polyprotein, partial | CSB-EP3114GLAe0 | CusabioAlternative Name(s): 3D polymerase (3Dpol) (Protein 3D) (3D)Gene Names: N/AResearch Areas: OthersOrganism: Enterovirus A71AA Sequence:...

Recombinant Enterovirus A71 Genome polyprotein, partial | CSB-EP3114GLAa2 | CusabioAlternative Name(s): VP4-VP2 (P1A) (Virion protein 4) (Capsid protein VP2) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (Picornain 2A)...

Recombinant Enterovirus A71 Genome polyprotein, partial | CSB-EP3114GLA | CusabioAlternative Name(s): VP4-VP2 (P1A) (Virion protein 4) (Capsid protein VP2) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (Picornain 2A) (Protein...

Recombinant Rat Mast cell protease 4 (Mcpt4) | CSB-EP311424RA | CusabioAlternative Name(s): Mast cell protease IV (rMCP-IV) (rMCP-4)Gene Names: Mcpt4Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Zaire ebolavirus Envelope glycoprotein (GP), partial | CSB-EP311249ZAT | CusabioAlternative Name(s): GP1,2 Short name: GP Cleaved into the following 3 chains: GP1 GP2 GP2-deltaGene Names: GPResearch Areas: MicrobiologyOrganism: Zaire...

Recombinant Chicken Vitellogenin-1 (VTG1), partial | CSB-EP311247CH | CusabioAlternative Name(s): Minor vitellogeninVitellogenin IGene Names: VTG1Research Areas: OthersOrganism: Gallus gallus (Chicken)AA Sequence:...

Recombinant Moringa oleifera Chitin-binding protein 3, partial | CSB-EP311177MIJ | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: othersOrganism: Moringa oleifera (Horseradish tree) (Moringa pterygosperma)AA Sequence:...

Recombinant Pseudomonas aeruginosa Type III export protein PscF (pscF) | CSB-EP310982EZX | CusabioAlternative Name(s): Pseudomonas secretion protein FGene Names: pscFResearch Areas: OthersOrganism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 /...

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2 | CSB-EP310896DNLa0 | CusabioAlternative Name(s): Allergen Api g 1.0201 (Allergen: Api g 1)Gene Names: N/AResearch Areas: OthersOrganism: Apium graveolens (Celery)AA Sequence:...

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2 | CSB-EP310896DNL | CusabioAlternative Name(s): Major allergen Api g 1; isoallergen 2; Allergen Api g 1.0201; allergen Api g 1Gene Names: N/AResearch Areas: OthersOrganism: Apium...

Recombinant Amanita muscaria DOPA 4, 5-dioxygenase (DODA) | CSB-EP310823AZZ | CusabioAlternative Name(s): /Gene Names: DODAResearch Areas: NeuroscienceOrganism: Amanita muscaria (Fly agaric)AA Sequence:...

Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB) | CSB-EP310587EYA(A4) | CusabioAlternative Name(s): Arg-gingipain Gingipain 2 RGP-2Gene Names: rgpBResearch Areas: OthersOrganism: Porphyromonas gingivalis (strain ATCC BAA-308 / W83)AA Sequence:...

Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial | CSB-EP310587EYA | CusabioAlternative Name(s): Arg-gingipain Gingipain 2 RGP-2Gene Names: rgpBResearch Areas: OthersOrganism: Porphyromonas gingivalis (strain ATCC BAA-308 / W83)AA...

Recombinant Human herpesvirus 2 Tegument protein VP22 (UL49), partial | CSB-EP310465HJX(A4) | CusabioAlternative Name(s): UL49Tegument protein VP22Gene Names: UL49Research Areas: OthersOrganism: Human herpesvirus 2 (strain HG52) (HHV-2) (Human herpes...

Recombinant Chlamydophila psittaci Major outer membrane porin (ompA) | CSB-EP310272CJB | CusabioAlternative Name(s): omp1Gene Names: ompAResearch Areas: MicrobiologyOrganism: Chlamydophila psittaci (Chlamydia psittaci)AA Sequence:...

Recombinant Bacillus subtilis L-arabinose isomerase (araA) | CSB-EP310162BRJ | CusabioAlternative Name(s): Gene Names: araAResearch Areas: OthersOrganism: Bacillus subtilis (strain 168)AA Sequence:...

Recombinant Drosophila melanogaster Stress-activated protein kinase JNK (bsk) | CSB-EP310094DLU | CusabioAlternative Name(s): Short name: dJNK Alternative name(s): Protein basketGene Names: bskResearch Areas: OthersOrganism: Drosophila melanogaster...

Recombinant Ceratopteris richardii Cyanovirin-N homolog | CSB-EP309974CGP | CusabioAlternative Name(s): Cyanovirin-N homolog; CV-N homologGene Names: N/AResearch Areas: OthersOrganism: Ceratopteris richardii (Triangle waterfern)AA Sequence:...

Recombinant Alternaria alternata Superoxide dismutase [Mn], mitochondrial, partial | CSB-EP309966AZV | CusabioAlternative Name(s): ; Superoxide dismutase [Mn]; mitochondrial; EC 1.15.1.1; Manganese-dependent superoxide dismutase; MnSOD; allergen Alt a...