Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial | CSB-EP310587EYA

(No reviews yet) Write a Review
SKU:
CSB-EP310587EYA
Availability:
3 - 7 Working Days
  • Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Porphyromonas gingivalis Gingipain R2 (rgpB), partial | CSB-EP310587EYA | Cusabio

Alternative Name(s): Arg-gingipain Gingipain 2 RGP-2

Gene Names: rgpB

Research Areas: Others

Organism: Porphyromonas gingivalis (strain ATCC BAA-308 / W83)

AA Sequence: YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 230-473aa

Sequence Info: Partial

MW: 43.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complement C3 and C5

Reference: "Comparative properties of two cysteine proteinases (gingipains R), the products of two related but individual genes of Porphyromonas gingivalis."Potempa J., Mikolajczyk-Pawlinska J., Brassell D., Nelson D., Thoegersen I.B., Enghild J.J., Travis J.J. Biol. Chem. 273:21648-21657(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Thiol protease. Acts synergistically with RgpA to catalyze the maturation of fimbrial subunits, such as FimA (By similarity). Its proteolytic activity is a major factor in both periodontal tissue destruction and in evasion of host defense mechanisms (Probable).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase C25 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P95493

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose