Sus scrofa Recombinant

Sus scrofa Recombinant
  • Recombinant Pig Interleukin-5 (IL5) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Interleukin-5 (IL5) | CSB-YP863067PI

    Recombinant Pig Interleukin-5 (IL5) | CSB-YP863067PI | CusabioAlternative Name(s): Eosinophil differentiation factor T-cell replacing factorGene Names: IL5Research Areas: ImmunologyOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €1,345.00
  • Recombinant Pig Transcobalamin-1 (TCN1) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Transcobalamin-1 (TCN1) | CSB-YP023317PI

    Recombinant Pig Transcobalamin-1 (TCN1) | CSB-YP023317PI | CusabioAlternative Name(s): CobalophilinHaptocorrin;Protein RTranscobalamin I ;TC I ;TCIGene Names: TCN1Research Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €1,345.00
  • Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB)
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) | CSB-YP021173PI

    Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) | CSB-YP021173PI | CusabioAlternative Name(s): Pulmonary surfactant-associated protein B(SP-B)(8 kDa protein)(Pulmonary surfactant-associated proteolipid SPL(Phe))Gene Names: SFTPBResearch...
    €491.00 - €1,453.00
  • Recombinant Pig E-selectin (SELE), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig E-selectin (SELE), partial | CSB-YP020975PI

    Recombinant Pig E-selectin (SELE), partial | CSB-YP020975PI | CusabioAlternative Name(s): CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ;ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ;LECAM2;; CD62EGene Names:...
    €383.00 - €1,345.00
  • Recombinant Pig Rhodopsin (RHO), partial
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Rhodopsin (RHO), partial | CSB-YP019681PI1

    Recombinant Pig Rhodopsin (RHO), partial | CSB-YP019681PI1 | CusabioAlternative Name(s): RHO1Gene Names: RHOResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQSource: YeastTag Info: N-terminal...
    €383.00 - €1,345.00
  • Recombinant Pig Saposin-B-Val (PSAP) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Saposin-B-Val (PSAP) | CSB-YP018836PI

    Recombinant Pig Saposin-B-Val (PSAP) | CSB-YP018836PI | CusabioAlternative Name(s): Cerebroside sulfate activator (CS-ACT) (Non-specific activator) (Sphingolipid activator protein 1) (SAP-1)Gene Names: PSAPResearch Areas: MetabolismOrganism: Sus scrofa...
    €383.00 - €1,345.00
  • Recombinant Pig Trypsin (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Trypsin | CSB-YP018814PI

    Recombinant Pig Trypsin | CSB-YP018814PI | CusabioAlternative Name(s): ; Trypsin; EC 3.4.21.4Gene Names: N/AResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €2,023.00
  • Recombinant Pig Prolactin (PRL) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Prolactin (PRL) | CSB-YP018724PI

    Recombinant Pig Prolactin (PRL) | CSB-YP018724PI | CusabioAlternative Name(s): PRL; Prolactin; PRLGene Names: PRLResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €1,345.00
  • Recombinant Pig Coagulation factor XII (F12), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Coagulation factor XII (F12), partial | CSB-YP007918PI

    Recombinant Pig Coagulation factor XII (F12), partial | CSB-YP007918PI | CusabioAlternative Name(s): Hageman factor Short name: HAFGene Names: F12Research Areas: CardiovascularOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €1,345.00
  • Recombinant Pig Erythropoietin (EPO) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Erythropoietin (EPO) | CSB-YP007743PI

    Recombinant Pig Erythropoietin (EPO) | CSB-YP007743PI | CusabioAlternative Name(s): EPOErythropoietinGene Names: EPOResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €339.00 - €1,345.00
  • Recombinant Pig Cadherin-3 (CDH3) The reducing (R) protein migrates as 43 kDa in SDS-PAGE may be due to glycosylation.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Cadherin-3 (CDH3) | CSB-YP005052PIa4

    Recombinant Pig Cadherin-3 (CDH3) | CSB-YP005052PIa4 | CusabioAlternative Name(s): Placental cadherinGene Names: CDH3Research Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €1,345.00
  • Recombinant Pig Cadherin-3 (CDH3) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Cadherin-3 (CDH3) | CSB-YP005052PI

    Recombinant Pig Cadherin-3 (CDH3) | CSB-YP005052PI | CusabioAlternative Name(s): Placental cadherinGene Names: CDH3Research Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €1,345.00
  • Recombinant Pig Calreticulin (CALR) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Calreticulin (CALR) | CSB-YP004458PI

    Recombinant Pig Calreticulin (CALR) | CSB-YP004458PI | CusabioAlternative Name(s): Alternative name(s):CRP55;Calregulin;Endoplasmic reticulum resident protein 60 Short name:ERp60 HACBPGene Names: CALRResearch Areas: Tags & Cell Markers Organism: Sus...
    €383.00 - €2,023.00
  • Recombinant Pig Complement C5a anaphylatoxin (C5) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Complement C5a anaphylatoxin (C5) | CSB-YP003995PI

    Recombinant Pig Complement C5a anaphylatoxin (C5) | CSB-YP003995PI | CusabioAlternative Name(s): C5; Complement C5a anaphylatoxinGene Names: C5Research Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €383.00 - €1,345.00
  • Recombinant Pig Rhodopsin (RHO), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Rhodopsin (RHO), partial | CSB-MP019681PI1

    Recombinant Pig Rhodopsin (RHO), partial | CSB-MP019681PI1 | CusabioAlternative Name(s): RHO1Gene Names: RHOResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQSource: Mammalian cellTag Info:...
    €529.00 - €3,703.00
  • Recombinant Pig Parathyroid hormone (PTH) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Parathyroid hormone (PTH) | CSB-MP018987PI

    Recombinant Pig Parathyroid hormone (PTH) | CSB-MP018987PI | CusabioAlternative Name(s): GTR2-2 Intestinal protein OCI-5 MXR7Gene Names: PTHResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence:...
    €386.00 - €900.00
  • Recombinant Pig Erythropoietin (EPO) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Erythropoietin (EPO) | CSB-MP007743PI

    Recombinant Pig Erythropoietin (EPO) | CSB-MP007743PI | CusabioAlternative Name(s): EPOErythropoietinGene Names: EPOResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €386.00 - €900.00
  • Recombinant Pig Integrin beta-1 (ITGB1), partial
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Integrin beta-1 (ITGB1), partial | CSB-EP884398PI

    Recombinant Pig Integrin beta-1 (ITGB1), partial | CSB-EP884398PI | CusabioAlternative Name(s): Fibronectin receptor subunit beta (VLA-4 subunit beta) (CD_antigen: CD29)Gene Names: ITGB1Research Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA...
    €352.00 - €1,702.00
  • Recombinant Pig Interleukin-5 (IL5) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Interleukin-5 (IL5) | CSB-EP863067PI

    Recombinant Pig Interleukin-5 (IL5) | CSB-EP863067PI | CusabioAlternative Name(s): Eosinophil differentiation factor T-cell replacing factorGene Names: IL5Research Areas: ImmunologyOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Alpha-synuclein (SNCA) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIe1

    Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIe1 | CusabioAlternative Name(s): /Gene Names: SNCAResearch Areas: NeuroscienceOrganism: Sus scrofa (Pig)AA Sequence:...
    €460.00 - €1,810.00
  • Recombinant Pig Alpha-synuclein (SNCA)
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIa0

    Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PIa0 | CusabioAlternative Name(s): SNCA; Alpha-synucleinGene Names: SNCAResearch Areas: NeuroscienceOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Alpha-synuclein (SNCA)
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PI

    Recombinant Pig Alpha-synuclein (SNCA) | CSB-EP666915PI | CusabioAlternative Name(s): SNCA; Alpha-synucleinGene Names: SNCAResearch Areas: NeuroscienceOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Beta-nerve growth factor (NGF) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Beta-nerve growth factor (NGF) | CSB-EP643662PI

    Recombinant Pig Beta-nerve growth factor (NGF) | CSB-EP643662PI | CusabioAlternative Name(s): Beta-NGFGene Names: NGFResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) | CSB-EP344230PI

    Recombinant Pig Antibacterial peptide PMAP-36 (PMAP36) | CSB-EP344230PI | CusabioAlternative Name(s): Myeloid antibacterial peptide 36Gene Names: PMAP36Research Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Antibacterial peptide PMAP-23 (PMAP23) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Antibacterial peptide PMAP-23 (PMAP23) | CSB-EP342648PI

    Recombinant Pig Antibacterial peptide PMAP-23 (PMAP23) | CSB-EP342648PI | CusabioAlternative Name(s): Myeloid antibacterial peptide 23Gene Names: PMAP23Research Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence: RIIDLLWRVRRPQKPKFVTVWVRSource: E.coliTag...
    €352.00 - €573.00
  • Recombinant Pig Protegrin-3 (NPG3) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Protegrin-3 (NPG3) | CSB-EP330145PI

    Recombinant Pig Protegrin-3 (NPG3) | CSB-EP330145PI | CusabioAlternative Name(s): PG-3Gene Names: NPG3Research Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence: RGGGLCYCRRRFCVCVGRSource: E.coliTag Info: N-terminal 6xHis-SUMO-taggedExpression Region:...
    €352.00 - €1,702.00
  • Recombinant Pig Odorant-binding protein
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Odorant-binding protein | CSB-EP305727PI

    Recombinant Pig Odorant-binding protein | CSB-EP305727PI | CusabioAlternative Name(s): Odorant-binding protein; OBPGene Names: N/AResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Uricase (UOX) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Uricase (UOX) | CSB-EP025648PI

    Recombinant Pig Uricase (UOX) | CSB-EP025648PI | CusabioAlternative Name(s): Urate oxidaseGene Names: UOXResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Sialoadhesin (SIGLEC1), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Sialoadhesin (SIGLEC1), partial | CSB-EP021293PI

    Recombinant Pig Sialoadhesin (SIGLEC1), partial | CSB-EP021293PI | CusabioAlternative Name(s): pSn;Sialic acid-binding Ig-like lectin 1;Siglec-1;p210Gene Names: SIGLEC1Research Areas: ImmunologyOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) | CSB-EP021173PI

    Recombinant Pig Pulmonary surfactant-associated protein B (SFTPB) | CSB-EP021173PI | CusabioAlternative Name(s): 8 kDa protein Pulmonary surfactant-associated proteolipid SPL(Phe)Gene Names: SFTPBResearch Areas: CardiovascularOrganism: Sus scrofa (Pig)AA...
    €460.00 - €1,810.00
  • Recombinant Pig Leukocyte elastase inhibitor (SERPINB1)
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Leukocyte elastase inhibitor (SERPINB1) | CSB-EP021065PI

    Recombinant Pig Leukocyte elastase inhibitor (SERPINB1) | CSB-EP021065PI | CusabioAlternative Name(s): Leukocyte neutral proteinase inhibitor (LNPI) (Serpin B1) (LEI) (ELANH2)Gene Names: SERPINB1Research Areas: CardiovascularOrganism: Sus scrofa (Pig)AA...
    €352.00 - €1,702.00
  • Recombinant Pig E-selectin (SELE), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig E-selectin (SELE), partial | CSB-EP020975PI

    Recombinant Pig E-selectin (SELE), partial | CSB-EP020975PI | CusabioAlternative Name(s): CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ;ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ;LECAM2;; CD62EGene Names:...
    €352.00 - €1,702.00
  • Recombinant Pig Rhodopsin (RHO), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Rhodopsin (RHO), partial | CSB-EP019681PI1e0

    Recombinant Pig Rhodopsin (RHO), partial | CSB-EP019681PI1e0 | CusabioAlternative Name(s): RHO1Gene Names: RHOResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQSource: E.coliTag Info: N-terminal...
    €352.00 - €1,702.00
  • Recombinant Pig Rhodopsin (RHO), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Rhodopsin (RHO), partial | CSB-EP019681PI1

    Recombinant Pig Rhodopsin (RHO), partial | CSB-EP019681PI1 | CusabioAlternative Name(s): RHO1Gene Names: RHOResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQSource: E.coliTag Info: N-terminal...
    €352.00 - €878.00
  • Recombinant Pig Prolactin (PRL) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Prolactin (PRL) | CSB-EP018724PI

    Recombinant Pig Prolactin (PRL) | CSB-EP018724PI | CusabioAlternative Name(s): PRL; Prolactin; PRLGene Names: PRLResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Somatotropin (GH1) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Somatotropin (GH1) | CSB-EP009407PI(A4)

    Recombinant Pig Somatotropin (GH1) | CSB-EP009407PI(A4) | CusabioAlternative Name(s): Growth hormoneGene Names: GH1Research Areas: Developmental BiologyOrganism: Sus scrofa (Pig)AA Sequence:...
    €298.00 - €718.00
  • Recombinant Pig Fatty acid-binding protein, heart (FABP3) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Fatty acid-binding protein, heart (FABP3) | CSB-EP007943PI

    Recombinant Pig Fatty acid-binding protein, heart (FABP3) | CSB-EP007943PI | CusabioAlternative Name(s): Fatty acid-binding protein 3 (Heart-type fatty acid-binding protein) (H-FABP)Gene Names: FABP3Research Areas: CardiovascularOrganism: Sus scrofa...
    €352.00 - €1,702.00
  • Recombinant Pig Coagulation factor XII (F12), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Coagulation factor XII (F12), partial | CSB-EP007918PI

    Recombinant Pig Coagulation factor XII (F12), partial | CSB-EP007918PI | CusabioAlternative Name(s): Hageman factor Short name: HAFGene Names: F12Research Areas: CardiovascularOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Erythropoietin (EPO) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Erythropoietin (EPO) | CSB-EP007743PI

    Recombinant Pig Erythropoietin (EPO) | CSB-EP007743PI | CusabioAlternative Name(s): EPOErythropoietinGene Names: EPOResearch Areas: CardiovascularOrganism: Sus scrofa (Pig)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Pig Calpain-2 catalytic subunit (CAPN2) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Calpain-2 catalytic subunit (CAPN2) | CSB-EP004496PI

    Recombinant Pig Calpain-2 catalytic subunit (CAPN2) | CSB-EP004496PI | CusabioAlternative Name(s): Calcium-activated neutral proteinase 2 ;CANP 2;Calpain M-type;Calpain-2 large subunit;Millimolar-calpain ;M-calpainGene Names: CAPN2Research Areas:...
    €352.00 - €1,702.00
  • Recombinant Pig Vasopressin V2 receptor (AVPR2), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Vasopressin V2 receptor (AVPR2), partial | CSB-EP002470PI

    Recombinant Pig Vasopressin V2 receptor (AVPR2), partial | CSB-EP002470PI | CusabioAlternative Name(s): V2R Alternative name(s): AVPR V2 Antidiuretic hormone receptor Renal-type arginine vasopressin receptorGene Names: AVPR2Research Areas:...
    €352.00 - €1,702.00
  • Recombinant Pig Aminopeptidase N (ANPEP), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Aminopeptidase N (ANPEP), partial | CSB-EP001827PI

    Recombinant Pig Aminopeptidase N (ANPEP), partial | CSB-EP001827PI | CusabioAlternative Name(s): Alanyl aminopeptidase (Aminopeptidase M) (AP-M) (Microsomal aminopeptidase) (gp130) (CD_antigen: CD13)Gene Names: ANPEPResearch Areas: ImmunologyOrganism:...
    €352.00 - €878.00
  • Recombinant Pig Interleukin-23 subunit alpha (IL23A) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Sus scrofa Recombinants

    Recombinant Pig Interleukin-23 subunit alpha (IL23A) | CSB-CF873568PI

    Recombinant Pig Interleukin-23 subunit alpha (IL23A) | CSB-CF873568PI | CusabioAlternative Name(s): Interleukin-23 subunit p19 (IL-23p19)Gene Names: IL23AResearch Areas: CancerOrganism: Sus scrofa (Pig)AA Sequence:...
    €644.00 - €902.00
  • Recombinant Pig Translocator protein (TSPO)