Cusabio Sus scrofa Recombinants
Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial | CSB-YP771258PI
- SKU:
- CSB-YP771258PI
- Availability:
- 25 - 35 Working Days
Description
Recombinant Pig Interleukin-4 receptor subunit alpha (IL4R), partial | CSB-YP771258PI | Cusabio
Alternative Name(s): CD_antigen: CD124 (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA)
Gene Names: IL4R
Research Areas: Cancer
Organism: Sus scrofa (Pig)
AA Sequence: VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 33-240aa
Sequence Info: Extracellular Domain
MW: 26.2
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2.
Reference: "Molecular cloning of the swine IL-4 receptor alpha and IL-13 receptor alpha 1 chains: effects of experimental Toxoplasma gondii and Ascaris suum infections on tissue mRNA levels." Zarlenga D.S. Jr., Dawson H., Solano-Aguilar G., Urban J.F. Jr. Submitted (MAR-2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q863Z5
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A