N-terminal 6xHis-KSI-tagged Recombinant

N-terminal 6xHis-KSI-tagged Recombinant
  • Recombinant Rotavirus A Non-structural glycoprotein 4, partial
    Cusabio Rotavirus A Recombinants

    Recombinant Rotavirus A Non-structural glycoprotein 4, partial | CSB-EP889507RFU

    Recombinant Rotavirus A Non-structural glycoprotein 4, partial | CSB-EP889507RFU | CusabioAlternative Name(s): NCVP5 (NS28) (NSP4)Gene Names: N/AResearch Areas: OthersOrganism: Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)AA...
    €352.00 - €1,702.00
  • Recombinant Dog C-C motif chemokine 17 (CCL17) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Virus & Bacteria Recombinants

    Recombinant Dog C-C motif chemokine 17 (CCL17) | CSB-EP856825DO

    Recombinant Dog C-C motif chemokine 17 (CCL17) | CSB-EP856825DO | CusabioAlternative Name(s): CC chemokine TARC;Small-inducible cytokine A17;Thymus and activation-regulated chemokineGene Names: CCL17Research Areas: ImmunologyOrganism: Canis familiaris...
    €352.00 - €1,702.00
  • Recombinant Mouse Beta-defensin 6 (Defb6) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Mouse Recombinants

    Recombinant Mouse Beta-defensin 6 (Defb6) | CSB-EP852771MO

    Recombinant Mouse Beta-defensin 6 (Defb6) | CSB-EP852771MO | CusabioAlternative Name(s): BD-6;mBD-6;Defensin, beta 6Gene Names: Defb6Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence: QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRKSource: E...
    €352.00 - €1,702.00
  • Recombinant Vespa mandarinia Vespakinin-M
    Cusabio Virus & Bacteria Recombinants

    Recombinant Vespa mandarinia Vespakinin-M | CSB-EP762592VBR

    Recombinant Vespa mandarinia Vespakinin-M | CSB-EP762592VBR | CusabioAlternative Name(s): Vespakinin-MGene Names: N/AResearch Areas: OthersOrganism: Vespa mandarinia(Asian giant hornet)AA Sequence: GRPPGFSPFRIDSource: E.coliTag Info: N-terminal...
    €352.00 - €1,702.00
  • Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial
    Cusabio Virus & Bacteria Recombinants

    Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial | CSB-EP742487SRE

    Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial | CSB-EP742487SRE | CusabioAlternative Name(s): Envelope glycoprotein(GP1,2)(GP) [Cleaved into: GP1; GP2; Shed GP(GP1,2-delta)]Gene Names: GPResearch Areas: OthersOrganism: Sudan ebolavirus...
    €352.00 - €1,702.00
  • Recombinant Pan troglodytes Beta-defensin 106A (DEFB106A)
    Cusabio Virus & Bacteria Recombinants

    Recombinant Pan troglodytes Beta-defensin 106A (DEFB106A) | CSB-EP711382EQV

    Recombinant Pan troglodytes Beta-defensin 106A (DEFB106A) | CSB-EP711382EQV | CusabioAlternative Name(s): Beta-defensin 6 (BD-6)(DEFB-6)(cBD-6)Gene Names: DEFB106AResearch Areas: ImmunologyOrganism: Pan troglodytes (Chimpanzee)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Conus marmoreus Conotoxin mr3e (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Virus & Bacteria Recombinants

    Recombinant Conus marmoreus Conotoxin mr3e | CSB-EP691651DWD

    Recombinant Conus marmoreus Conotoxin mr3e | CSB-EP691651DWD | CusabioAlternative Name(s): Mr3.4 Mr3.7Gene Names: N/AResearch Areas: othersOrganism: Conus marmoreus (Marble cone)AA Sequence: VCCPFGGCHELCYCCDSource: E.coliTag Info: N-terminal...
    €352.00 - €1,702.00
  • Recombinant Apis mellifera carnica Defensin-1
    Cusabio Virus & Bacteria Recombinants

    Recombinant Apis mellifera carnica Defensin-1 | CSB-EP686329ADAM

    Recombinant Apis mellifera carnica Defensin-1 | CSB-EP686329ADAM | CusabioAlternative Name(s): Defensin-1Gene Names: N/AResearch Areas: OthersOrganism: Apis mellifera carnica (Carniolan honeybee)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Bacillus subtilis Subtilosin-A (sboA) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Bacillus subtilis Recombinants

    Recombinant Bacillus subtilis Subtilosin-A (sboA) | CSB-EP522484BRJe3

    Recombinant Bacillus subtilis Subtilosin-A (sboA) | CSB-EP522484BRJe3 | CusabioAlternative Name(s): Antilisterial bacteriocin subtilosin (sbo)Gene Names: sboAResearch Areas: Signal TransductionOrganism: Bacillus subtilis (strain 168)AA Sequence:...
    €352.00 - €573.00
  • Recombinant Influenza A virus protein PB1-F2 (PB1)
    Cusabio Influenza A virus Recombinants

    Recombinant Influenza A virus protein PB1-F2 (PB1) | CSB-EP455303IMU

    Recombinant Influenza A virus protein PB1-F2 (PB1) | CSB-EP455303IMU | CusabioAlternative Name(s): Protein PB1-F2Gene Names: PB1Research Areas: OthersOrganism: Influenza A virus (strain A/Swine/Wisconsin/1/1961 H1N1)AA Sequence: MGQEQGIPWILSource: E...
    €352.00 - €1,702.00
  • Recombinant Human IgA-inducing protein homolog (IGIP)
    Cusabio Human Recombinants

    Recombinant Human IgA-inducing protein homolog (IGIP) | CSB-EP411460HU

    Recombinant Human IgA-inducing protein homolog (IGIP) | CSB-EP411460HU | CusabioAlternative Name(s): C5orf53Gene Names: IGIPResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence: KSPCGNQANVLCISRLEFVQYQSSource: E.coliTag Info: N-terminal...
    €352.00 - €1,702.00
  • Recombinant Bubalus bubalis Lingual antimicrobial peptide
    Cusabio Virus & Bacteria Recombinants

    Recombinant Bubalus bubalis Lingual antimicrobial peptide | CSB-EP389004BWX

    Recombinant Bubalus bubalis Lingual antimicrobial peptide | CSB-EP389004BWX | CusabioAlternative Name(s): Lingual antimicrobial peptideGene Names: N/AResearch Areas: OthersOrganism: Bubalus bubalis (Domestic water buffalo)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Bovine Alpha-S2-casein (CSN1S2) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Bos taurus Recombinants

    Recombinant Bovine Alpha-S2-casein (CSN1S2) | CSB-EP355862BO

    Recombinant Bovine Alpha-S2-casein (CSN1S2) | CSB-EP355862BO | CusabioAlternative Name(s): Casocidin-1;Casocidin-IGene Names: CSN1S2Research Areas: OthersOrganism: Bos taurus (Bovine)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Herpes simplex virus type 2 ICP47 protein (US12) Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP353051HGH could indicate that this peptide derived from E.coli-expressed Herpes simplex virus type 2 (strain SA8) (Simian agent 8) US12.
    Cusabio Virus & Bacteria Recombinants

    Recombinant Herpes simplex virus type 2 ICP47 protein (US12) | CSB-EP353051HGH

    Recombinant Herpes simplex virus type 2 ICP47 protein (US12) | CSB-EP353051HGH | CusabioAlternative Name(s): Immediate-early protein IE12 (Immediate-early-5) (Infected cell protein 47) (US12 protein) (Vmw12)Gene Names: US12Research Areas: OthersOrganism:...
    €352.00 - €1,702.00
  • Recombinant Daucus carota Phytosulfokine-alpha
    Cusabio Virus & Bacteria Recombinants

    Recombinant Daucus carota Phytosulfokine-alpha | CSB-EP348219DIR

    Recombinant Daucus carota Phytosulfokine-alpha | CSB-EP348219DIR | CusabioAlternative Name(s): PSK-alphaGene Names: N/AResearch Areas: OthersOrganism: Daucus carota(Wild carrot)AA Sequence: YIYTQSource: E.coliTag Info: N-terminal...
    €352.00 - €1,702.00
  • Recombinant Podisus maculiventris Thanatin (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Virus & Bacteria Recombinants

    Recombinant Podisus maculiventris Thanatin | CSB-EP345509PNT

    Recombinant Podisus maculiventris Thanatin | CSB-EP345509PNT | CusabioAlternative Name(s): Gene Names: N/AResearch Areas: OthersOrganism: Podisus maculiventris (Spined soldier bug)AA Sequence: GSKKPVPIIYCNRRTGKCQRMSource: E.coliTag Info: N-terminal...
    €352.00 - €1,702.00
  • Recombinant Yersinia kristensenii Heat-stable enterotoxin (yst) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Virus & Bacteria Recombinants

    Recombinant Yersinia kristensenii Heat-stable enterotoxin (yst) | CSB-EP339176YAE

    Recombinant Yersinia kristensenii Heat-stable enterotoxin (yst) | CSB-EP339176YAE | CusabioAlternative Name(s): yst; Heat-stable enterotoxinGene Names: ystResearch Areas: OthersOrganism: Yersinia kristenseniiAA Sequence: SDWCCEVCCNPACAGCSource: E.coliTag...
    €352.00 - €1,702.00
  • Recombinant Escherichia coli Uncharacterized protein yjbL (yjbL) (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Escherichia coli Recombinants

    Recombinant Escherichia coli Uncharacterized protein yjbL (yjbL) | CSB-EP335758ENV

    Recombinant Escherichia coli Uncharacterized protein yjbL (yjbL) | CSB-EP335758ENV | CusabioAlternative Name(s): yjbL; b4047; JW4007; Uncharacterized protein YjbLGene Names: yjbLResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Human herpesvirus 1 Glycoprotein C (GC), partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Human herpesvirus 1 Recombinants

    Recombinant Human herpesvirus 1 Glycoprotein C (GC), partial | CSB-EP329861HSP1

    Recombinant Human herpesvirus 1 Glycoprotein C (GC), partial | CSB-EP329861HSP1 | CusabioAlternative Name(s): UL44Gene Names: GCResearch Areas: Signal TransductionOrganism: Human herpesvirus 1 (strain KOS) (HHV-1) (Human herpes simplex virus 1)AA...
    €352.00 - €1,702.00
  • Recombinant Ornithorhynchus anatinus Defensin-A1
    Cusabio Virus & Bacteria Recombinants

    Recombinant Ornithorhynchus anatinus Defensin-A1 | CSB-EP315251OEX

    Recombinant Ornithorhynchus anatinus Defensin-A1 | CSB-EP315251OEX | CusabioAlternative Name(s): DefA1 (OaDefA1)Gene Names: N/AResearch Areas: OthersOrganism: Ornithorhynchus anatinus(Duckbill platypus)AA Sequence: DTTFCRCRVSCNILEKYSGKCELSGRTARICCSource:...
    €352.00 - €1,702.00
  • Recombinant Leuconostoc mesenteroides Dextransucrase (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Virus & Bacteria Recombinants

    Recombinant Leuconostoc mesenteroides Dextransucrase | CSB-EP308923LPG

    Recombinant Leuconostoc mesenteroides Dextransucrase | CSB-EP308923LPG | CusabioAlternative Name(s): Glucansucrase (Sucrose 6-glucosyltransferase)Gene Names: N/AResearch Areas: OthersOrganism: Leuconostoc mesenteroidesAA Sequence: GLPGYFGVNSource: E...
    €352.00 - €1,702.00
  • Recombinant Anabaena sp. Superoxide dismutase [Fe] (sodB), partial
    Cusabio Virus & Bacteria Recombinants

    Recombinant Anabaena sp. Superoxide dismutase [Fe] (sodB), partial | CSB-EP307060AJM

    Recombinant Anabaena sp. Superoxide dismutase [Fe] (sodB), partial | CSB-EP307060AJM | CusabioAlternative Name(s): sodB; Superoxide dismutase [Fe]; EC 1.15.1.1; FragmentGene Names: sodBResearch Areas: OthersOrganism: Anabaena sp. (strain L31)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Olea europaea Pollen allergen Ole e 7, partial
    Cusabio Virus & Bacteria Recombinants

    Recombinant Olea europaea Pollen allergen Ole e 7, partial | CSB-EP305742OEC

    Recombinant Olea europaea Pollen allergen Ole e 7, partial | CSB-EP305742OEC | CusabioAlternative Name(s): Allergen Ole e VII (Allergen: Ole e 7)Gene Names: N/AResearch Areas: OthersOrganism: Olea europaea(Common olive)AA Sequence:...
    €352.00 - €1,702.00
  • Recombinant Bacillus cereus Enterotoxin, partial (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    Cusabio Virus & Bacteria Recombinants

    Recombinant Bacillus cereus Enterotoxin, partial | CSB-EP302168BQJ

    Recombinant Bacillus cereus Enterotoxin, partial | CSB-EP302168BQJ | CusabioAlternative Name(s): 45 kDa proteinGene Names: N/AResearch Areas: OthersOrganism: Bacillus cereusAA Sequence: AQNVIAPNTLSNSIRMLGSQSPLIQAYGSource: E.coliTag Info: N-terminal...
    €352.00 - €1,702.00
  • Recombinant Chicken Antimicrobial peptide CHP1
    Cusabio Gallus gallus Recombinants

    Recombinant Chicken Antimicrobial peptide CHP1 | CSB-EP301330CH

    Recombinant Chicken Antimicrobial peptide CHP1 | CSB-EP301330CH | CusabioAlternative Name(s): Chicken heterophil peptide 1Gene Names: N/AResearch Areas: OthersOrganism: Gallus gallus (Chicken)AA Sequence: GRKSDCFRKSGFCAFLKCPSLTLISGKCSRFYLCCKRIRSource: E...
    €352.00 - €1,702.00
  • Recombinant Human Thrombomodulin (THBD), partial
    Cusabio Human Recombinants

    Recombinant Human Thrombomodulin (THBD), partial | CSB-EP023486HU2

    Recombinant Human Thrombomodulin (THBD), partial | CSB-EP023486HU2 | CusabioAlternative Name(s): Fetomodulin (CD_antigen: CD141) (TM) (THRM)Gene Names: THBDResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...
    €266.00 - €1,440.00
  • Recombinant Rat Serotransferrin (Tf)
    Cusabio Rattus norvegicus Recombinants

    Recombinant Rat Serotransferrin (Tf) | CSB-EP023412RA

    Recombinant Rat Serotransferrin (Tf) | CSB-EP023412RA | CusabioAlternative Name(s): Beta-1 metal-binding globulin (Liver regeneration-related protein LRRG03) (Siderophilin) (Transferrin)Gene Names: TfResearch Areas: Epigenetics and Nuclear...
    €352.00 - €573.00
  • Recombinant Bovine Rhodopsin (RHO), partial
    Cusabio Bos taurus Recombinants

    Recombinant Bovine Rhodopsin (RHO), partial | CSB-EP019681BO1

    Recombinant Bovine Rhodopsin (RHO), partial | CSB-EP019681BO1 | CusabioAlternative Name(s): RHO; RhodopsinGene Names: RHOResearch Areas: Signal TransductionOrganism: Bos taurus (Bovine)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQSource: E.coliTag...
    €352.00 - €1,702.00
  • Recombinant Rat Endothelin-1 (Edn1), partial
    Cusabio Rattus norvegicus Recombinants

    Recombinant Rat Endothelin-1 (Edn1), partial | CSB-EP007400RA

    Recombinant Rat Endothelin-1 (Edn1), partial | CSB-EP007400RA | CusabioAlternative Name(s): Preproendothelin-1 (PPET1) Gene Names: Edn1Research Areas: CancerOrganism: Rattus norvegicus (Rat)AA Sequence: CSCSSLMDKECVYFCHLDIIWSource: E.coliTag Info:...
    €352.00 - €1,702.00
  • Recombinant Dog Osteocalcin (BGLAP)
    Cusabio Canis lupus familiaris Recombinants

    Recombinant Dog Osteocalcin (BGLAP) | CSB-EP002682DO

    Recombinant Dog Osteocalcin (BGLAP) | CSB-EP002682DO | CusabioAlternative Name(s): Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)Gene Names: BGLAPResearch Areas: Signal TransductionOrganism: Canis lupus familiaris (Dog) (Canis...
    €352.00 - €1,702.00
  • Recombinant Chicken Osteocalcin (BGLAP)
    Cusabio Gallus gallus Recombinants

    Recombinant Chicken Osteocalcin (BGLAP) | CSB-EP002682CH

    Recombinant Chicken Osteocalcin (BGLAP) | CSB-EP002682CH | CusabioAlternative Name(s): Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)Gene Names: BGLAPResearch Areas: Signal TransductionOrganism: Gallus gallus (Chicken)AA Sequence:...
    €352.00 - €1,702.00