Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA) | CSB-EP316432DSB

(No reviews yet) Write a Review
SKU:
CSB-EP316432DSB
Availability:
3 - 7 Working Days
  • Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Chlamydia trachomatis Small cysteine-rich outer membrane protein OmcA (OmcA) | CSB-EP316432DSB | Cusabio

Alternative Name(s): 9KDA cysteine-rich lipoprotein Short name:9KDA-CRP

Gene Names: omcA

Research Areas: Microbiology

Organism: Chlamydia trachomatis (strain D/UW-3/Cx)

AA Sequence: CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 19-88aa

Sequence Info: Full Length of Mature Protein

MW: 23.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity).

Reference: "Cysteine-rich outer membrane proteins of Chlamydia trachomatis display compensatory sequence changes between biovariants."Allen J.E., Cerrone M.C., Beatty P.R., Stephens R.S.Mol. Microbiol. 4:1543-1550(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan (By similarity).

Involvement in disease:

Subcellular Location: Cell outer membrane, Lipid-anchor

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CC05

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose