Recombinant Dahlia merckii Defensin-like protein 1 | CSB-EP316614DAE

Recombinant Dahlia merckii Defensin-like protein 1 | CSB-EP316614DAE | Cusabio

Alternative Name(s): Cysteine-rich antimicrobial protein 1 Defensin AMP1

Gene Names: N/A

Research Areas: Others

Organism: Dahlia merckii (Bedding dahlia)

AA Sequence: ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 1-50aa

Sequence Info: Full Length

MW: 19.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca2+ uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Reference: "Fungal membrane responses induced by plant defensins and thionins." Thevissen K., Ghazi A., De Samblanx G.W., Brownlee C., Osborn R.W., Broekaert W.F. J. Biol. Chem. 271:15018-15025(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Possesses antimicrobial activity sensitive to inorganic cations. Has no inhibitory effect on insect gut alpha-amylase. Induces potential changes in fungal membranes and increased K+ efflux and Ca(2+) uptake. Interacts with sphingolipids and ergosterols found in fungal plasma membranes.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: DEFL family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0C8Y4

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A