E.coli Recombinant

Recombinant Human Titin (TTN), partial | CSB-EP025267HU | CusabioAlternative Name(s): Connectin Rhabdomyosarcoma antigen MU-RMS-40.14Gene Names: TTNResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tetraspanin-7 (TSPAN7), partial | CSB-EP025165HU | CusabioAlternative Name(s): Cell surface glycoprotein A15Membrane component chromosome X surface marker 1T-cell acute lymphoblastic leukemia-associated antigen 1 ;TALLA-1Transmembrane 4...

Recombinant Human Tetraspanin-2 (TSPAN2), partial | CSB-EP025157HU1e1 | CusabioAlternative Name(s): Tspan-2 (Tetraspan NET-3)Gene Names: TSPAN2Research Areas: Stem CellsOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Thymic stromal lymphopoietin (TSLP) | CSB-EP025141HU | CusabioAlternative Name(s): Thymic stromal lymphopoietin; Thymic stromal lymphopoietin protein TSLP; Tslp; TSLP protein; TSLP_HUMANGene Names: TSLPResearch Areas:...

Recombinant Rat Thyrotropin subunit beta (Tshb) | CSB-EP025130RA | CusabioAlternative Name(s): Thyroid-stimulating hormone subunit betaGene Names: TshbResearch Areas: Signal TransductionOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Thyrotropin subunit beta (TSHB) | CSB-EP025130HU | CusabioAlternative Name(s): Thyroid-stimulating hormone subunit beta ;TSH-B ;TSH-betaThyrotropin beta chainINN: Thyrotropin alfaGene Names: TSHBResearch Areas: Signal...

Recombinant Dog Thyrotropin subunit beta (TSHB) | CSB-EP025130DO | CusabioAlternative Name(s): Thyroid-stimulating hormone subunit beta (TSH-B) (TSH-beta) (Thyrotropin beta chain)Gene Names: TSHBResearch Areas: CancerOrganism: Canis lupus familiaris...

Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial | CSB-EP025074HU | CusabioAlternative Name(s): Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120Gene Names:...

Recombinant Mouse 60 kDa SS-A/Ro ribonucleoprotein (Trove2) | CSB-EP025071MO | CusabioAlternative Name(s): TROVE domain family member 2 (60 kDa Ro protein) (60 kDa ribonucleoprotein Ro) (RoRNP) (Ssa2)Gene Names: Trove2Research Areas: Epigenetics and...

Recombinant Human 60 kDa SS-A/Ro ribonucleoprotein (RO60), partial | CSB-EP025071HU1 | CusabioAlternative Name(s): Ro 60KDA autoantigen;Sjoegren syndrome antigen A2Sjoegren syndrome type A antigen ;SS-ATROVE domain family member 2Gene Names: RO60Research...

Recombinant Human Transcription intermediary factor 1-alpha (TRIM24), partial | CSB-EP024460HU | CusabioAlternative Name(s): E3 ubiquitin-protein ligase TRIM24RING finger protein 82Tripartite motif-containing protein 24Gene Names: TRIM24Research Areas:...

Recombinant Human E3 ubiquitin-protein ligase TRIM21 (TRIM21) | CSB-EP024457HU | CusabioAlternative Name(s): 52 kDa Ro protein 52 kDa ribonucleoprotein autoantigen Ro/SS-A RING finger protein 81 RING-type E3 ubiquitin transferase TRIM21 Ro(SS-A) Sjoegren...

Recombinant Human TP53-regulated inhibitor of apoptosis 1 (TRIAP1) | CSB-EP024443HU | CusabioAlternative Name(s): Protein 15E1.1 WF-1 p53-inducible cell-survival factorGene Names: TRIAP1Research Areas: Cell Biology Organism: Homo sapiens (Human)AA...

Recombinant Mouse Triggering receptor expressed on myeloid cells 2 (Trem2), partial | CSB-EP024405MO | CusabioAlternative Name(s): Short name: TREM-2 Alternative name(s): Triggering receptor expressed on monocytes 2Gene Names: Trem2Research Areas:...

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial | CSB-EP024405HUd1 | CusabioAlternative Name(s): Triggering receptor expressed on myeloid cells 2(TREM-2)(Triggering receptor expressed on monocytes 2)Gene Names:...

Recombinant Human Triggering receptor expressed on myeloid cells 2 (TREM2), partial | CSB-EP024405HU | CusabioAlternative Name(s): Triggering receptor expressed on monocytes 2Gene Names: TREM2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA...

Recombinant Human T cell receptor beta constant 2 (TRBC2), partial | CSB-EP024292HU | CusabioAlternative Name(s): TCRBC2Gene Names: TRBC2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human T cell receptor beta constant 1 (TRBC1), partial | CSB-EP024291HU1 | CusabioAlternative Name(s): TRBC1; T cell receptor beta constant 1Gene Names: TRBC1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human TNF receptor-associated factor 6 (TRAF6) | CSB-EP024154HUe1 | CusabioAlternative Name(s): E3 ubiquitin-protein ligase TRAF6 (Interleukin-1 signal transducer) (RING finger protein 85) (RING-type E3 ubiquitin transferase TRAF6)...

Recombinant Human TNF receptor-associated factor 6 (TRAF6) | CSB-EP024154HU | CusabioAlternative Name(s): E3 ubiquitin-protein ligase TRAF6Interleukin-1 signal transducerRING finger protein 85Gene Names: TRAF6Research Areas: Developmental...

Recombinant Human TNF receptor-associated factor 5 (TRAF5) | CSB-EP024153HU | CusabioAlternative Name(s): RING finger protein 84Gene Names: TRAF5Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human TNF receptor-associated factor 3 (TRAF3) | CSB-EP024148HUe1 | CusabioAlternative Name(s): CAP-1 (CD40 receptor-associated factor 1) (CRAF1) (CD40-binding protein) (CD40BP) (LMP1-associated protein 1) (LAP1) (RING-type E3 ubiquitin...

Recombinant Human TNF receptor-associated factor 3 (TRAF3) | CSB-EP024148HU | CusabioAlternative Name(s): CAP-1 (CD40 receptor-associated factor 1) (CRAF1) (CD40-binding protein) (CD40BP) (LMP1-associated protein 1) (LAP1) (CAP1) (CRAF1)Gene Names:...

Recombinant Human T cell receptor alpha constant (TRAC) | CSB-EP024144HU | CusabioAlternative Name(s): TRAC; TCRA; T cell receptor alpha constantGene Names: TRACResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Translationally-controlled tumor protein (Tpt1) | CSB-EP024134MO | CusabioAlternative Name(s): 21KDA polypeptidep21p23Gene Names: Tpt1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Protein-tyrosine sulfotransferase 2 (TPST2) | CSB-EP024133HU | CusabioAlternative Name(s): Tyrosylprotein sulfotransferase 2 ;TPST-2Gene Names: TPST2Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Tryptase beta-2 (Tpsb2) | CSB-EP024128MO | CusabioAlternative Name(s): Mast cell protease 6 ;mMCP-6Gene Names: Tpsb2Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Tryptase beta-2 (TPSB2) | CSB-EP024128HUb1 | CusabioAlternative Name(s): Tryptase IIGene Names: TPSB2Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tryptase beta-2 (TPSB2) | CSB-EP024128HU | CusabioAlternative Name(s): Tryptase IIGene Names: TPSB2Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Tryptase (Tpsab1) | CSB-EP024127RA | CusabioAlternative Name(s): Mast cell protease 7Gene Names: Tpsab1Research Areas: ImmunologyOrganism: Rattus norvegicus (Rat) AA Sequence:...

Recombinant Mouse Tryptase (Tpsab1), partial | CSB-EP024127MO | CusabioAlternative Name(s): Mast cell protease 7 ;mMCP-7Tryptase alpha/beta-1Gene Names: Tpsab1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Tubulin polymerization-promoting protein (TPPP) | CSB-EP024115HU | CusabioAlternative Name(s): 25KDA brain-specific protein TPPP/p25 p24 p25-alphaGene Names: TPPPResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA...

Recombinant Human Tripeptidyl-peptidase 2 (TPP2), partial | CSB-EP024114HU | CusabioAlternative Name(s): Tripeptidyl aminopeptidase ?Tripeptidyl-peptidase II? ?TPP-II?Gene Names: TPP2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Thiopurine S-methyltransferase (TPMT), partial | CSB-EP024110HU1 | CusabioAlternative Name(s): Thiopurine methyltransferaseGene Names: TPMTResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tropomyosin alpha-4 chain (TPM4) | CSB-EP024108HU | CusabioAlternative Name(s): TM30p1 Tropomyosin-4Gene Names: TPM4Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tropomyosin alpha-3 chain (TPM3) | CSB-EP024106HU | CusabioAlternative Name(s): Gamma-tropomyosin Tropomyosin-3 Tropomyosin-5Gene Names: TPM3Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tropomyosin beta chain (TPM2), partial | CSB-EP024105HU1 | CusabioAlternative Name(s): Beta-tropomyosin;Tropomyosin-2Gene Names: TMSBResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rabbit Tropomyosin alpha-1 chain (TPM1) | CSB-EP024104RB | CusabioAlternative Name(s): Alpha-tropomyosin Tropomyosin-1 TPMAGene Names: TPM1Research Areas: Signal TransductionOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Human Thiamin pyrophosphokinase 1 (TPK1) | CSB-EP024103HU | CusabioAlternative Name(s): Placental protein 20Gene Names: TPK1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Tryptophan 5-hydroxylase 1 (Tph1) | CSB-EP024100MO | CusabioAlternative Name(s): Tryptophan 5-monooxygenase 1Gene Names: Tph1Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Tumor protein D52 (TPD52) | CSB-EP024096HU | CusabioAlternative Name(s): Protein N8Gene Names: TPD52Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Trophoblast glycoprotein (Tpbg), partial | CSB-EP024093RA | CusabioAlternative Name(s): 5T4 oncofetal trophoblast glycoprotein Short name: 5T4 oncotrophoblast glycoprotein Wnt-activated inhibitory factor 1 Short name: WAIF1Gene Names:...

Recombinant Macaca fascicularis Trophoblast glycoprotein (TPBG), partial | CSB-EP024093MOV | CusabioAlternative Name(s): Wnt-activated inhibitory factor 1 Short name: WAIF1Gene Names: TPBGResearch Areas: OthersOrganism: Macaca fascicularis (Crab-eating...

Recombinant Mouse Cellular tumor antigen p53 (Tp53) | CSB-EP024077MO | CusabioAlternative Name(s): Tumor suppressor p53Gene Names: Tp53Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Cellular tumor antigen p53 (TP53) | CSB-EP024077HU | CusabioAlternative Name(s): Antigen NY-CO-13;Phosphoprotein p53Tumor suppressor p53Gene Names: TP53Research Areas: ApoptosisOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40) | CSB-EP024050HU | CusabioAlternative Name(s): Protein Haymaker Translocase of outer membrane 40KDA subunit homolog p38.5Gene Names: TOMM40Research Areas: Tags & Cell Markers...

Recombinant Astacus leptodactylus Troponin I | CSB-EP024013PPO | CusabioAlternative Name(s): Gene Names: N/AResearch Areas: OthersOrganism: Astacus leptodactylus (Turkish narrow-clawed crayfish) (Pontastacus leptodactylus)AA Sequence:...

Recombinant Mouse Troponin I, fast skeletal muscle (Tnni2) | CSB-EP024012MO | CusabioAlternative Name(s): Troponin I, fast-twitch isoformGene Names: Tnni2Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Troponin C, skeletal muscle (TNNC2) | CSB-EP024010HU | CusabioAlternative Name(s): TNNC2; Troponin C; skeletal muscleGene Names: TNNC2Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Tenomodulin (Tnmd), partial | CSB-EP024007MO | CusabioAlternative Name(s): Chondromodulin-1-like protein (ChM1L) (mChM1L) (Chondromodulin-I-like protein) (Myodulin) (Tendin) (TeM) (mTeM) (Chm1l)Gene Names: TnmdResearch Areas:...

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial | CSB-EP023994RB1 | CusabioAlternative Name(s): Tumor necrosis factor ligand superfamily member 4(OX40 ligand)(OX40L)(CD antigen CD252)Gene Names: TNFSF4Research...

Recombinant Human Tumor necrosis factor ligand superfamily member 12 (TNFSF12), partial | CSB-EP023987HU | CusabioAlternative Name(s): APO3 ligandTNF-related weak inducer of apoptosis ;TWEAKGene Names: TNFSF12Research Areas: CancerOrganism: Homo sapiens...

Recombinant Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11), partial | CSB-EP023986MO | CusabioAlternative Name(s): Osteoclast differentiation factor Short name:ODF Osteoprotegerin ligand Short name:OPGL Receptor activator of nuclear...

Recombinant Human Tumor necrosis factor ligand superfamily member 10 (TNFSF10) , partial | CSB-EP023985HUe0 | CusabioAlternative Name(s): Apo-2 ligand ;Apo-2LTNF-related apoptosis-inducing ligand ;Protein TRAIL; CD253Gene Names: TNFSF10Research Areas:...

Recombinant Human Tumor necrosis factor ligand superfamily member 10 (TNFSF10) , partial | CSB-EP023985HU | CusabioAlternative Name(s): Apo-2 ligand ;Apo-2LTNF-related apoptosis-inducing ligand ;Protein TRAIL; CD253Gene Names: TNFSF10Research Areas:...

Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial | CSB-EP023981MO | CusabioAlternative Name(s): OX40 antigen OX40L receptor CD_antigen: CD134Gene Names: Tnfrsf4Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Human Tumor necrosis factor receptor superfamily member 21 (TNFRSF21), partial | CSB-EP023979HU | CusabioAlternative Name(s): Death receptor 6; CD358Gene Names: TNFRSF21Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tumor necrosis factor receptor superfamily member 1B (TNFRSF1B), partial | CSB-EP023978HU1 | CusabioAlternative Name(s): Tumor necrosis factor receptor 2 ;TNF-R2Tumor necrosis factor receptor type II ;TNF-RII ;TNFR-IIp75p80 TNF-alpha...

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial | CSB-EP023974HU1 | CusabioAlternative Name(s): B-cell maturation proteinGene Names: TNFRSF17Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tumor necrosis factor-inducible gene 6 protein (TNFAIP6) | CSB-EP023959HU | CusabioAlternative Name(s): Hyaluronate-binding protein;TNF-stimulated gene 6 protein ;TSG-6Tumor necrosis factor alpha-induced protein 6 ;TNF alpha-induced...

Recombinant Sheep Tumor necrosis factor (TNF), Partial | CSB-EP023955SH | CusabioAlternative Name(s): Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-aGene Names: TNFResearch Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Mouse Tumor necrosis factor (Tnf), partial | CSB-EP023955MO1 | CusabioAlternative Name(s): Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 Short name:TNF-aGene Names: TnfResearch Areas: OthersOrganism: Mus musculus...

Recombinant Human Tumor necrosis factor (TNF), partial | CSB-EP023955HU | CusabioAlternative Name(s): Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-aGene Names: TNFResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA...

Recombinant Bovie Tumor necrosis factor (TNF), partial | CSB-EP023955BOe0 | CusabioAlternative Name(s): Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-aGene Names: TNFResearch Areas: OthersOrganism: Bos taurus (Bovine)AA...

Recombinant Bovie Tumor necrosis factor (TNF), partial | CSB-EP023955BO | CusabioAlternative Name(s): Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-aGene Names: TNFResearch Areas: OthersOrganism: Bos taurus (Bovine)AA...

Recombinant Human Thioredoxin-related transmembrane protein 2 (TMX2), partial | CSB-EP023951HU | CusabioAlternative Name(s): Cell proliferation-inducing gene 26 protein Thioredoxin domain-containing protein 14Gene Names: TMX2Research Areas: Cell...

Recombinant Human Thymosin beta-10 (TMSB10) | CSB-EP023931HU | CusabioAlternative Name(s): Gene Names: TMSB10Research Areas: Signal TransductionOrganism: Homo sapiens(Human)AA Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEISSource: E.coliTag Info:...

Recombinant Human Tropomodulin-1 (TMOD1) | CSB-EP023909HU | CusabioAlternative Name(s): Erythrocyte tropomodulinGene Names: TMOD1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Trimethyllysine dioxygenase, mitochondrial (TMLHE) | CSB-EP023908HU | CusabioAlternative Name(s): Epsilon-trimethyllysine 2-oxoglutarate dioxygenase;Epsilon-trimethyllysine hydroxylaseTML hydroxylaseTML-alpha-ketoglutarate dioxygenase...

Recombinant Human Transmembrane protein 98 (TMEM98) | CSB-EP023901HU | CusabioAlternative Name(s): Protein TADA1Gene Names: TMEM98Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Transmembrane protein 44 (TMEM44), partial | CSB-EP023841HU | CusabioAlternative Name(s): DKFZp686O18124; TMEM44; TMM44_HUMAN; Transmembrane protein 44Gene Names: TMEM44Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA...

Recombinant Human Transmembrane protein 25 (TMEM25) | CSB-EP023821HU | CusabioAlternative Name(s): 0610039J01Rik; FLJ14399; Tmem25; TMM25_HUMAN; Transmembrane protein 25Gene Names: TMEM25Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA...

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial | CSB-EP023813HU | CusabioAlternative Name(s): Transmembrane protein 219Gene Names: TMEM219Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Cell surface hyaluronidase (Tmem2), partial | CSB-EP023791MO | CusabioAlternative Name(s): Transmembrane protein 2 (Kiaa1412)Gene Names: Tmem2Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Cell surface hyaluronidase (TMEM2), partial | CSB-EP023791HU | CusabioAlternative Name(s): Transmembrane protein 2 (KIAA1412)Gene Names: TMEM2Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial | CSB-EP023742PYX | CusabioAlternative Name(s): TMEM168; Transmembrane protein 168Gene Names: TMEM168Research Areas: OthersOrganism: Pongo abelii (Sumatran orangutan) (Pongo pygmaeus...

Recombinant Human Transmembrane protein 14B (TMEM14B) | CSB-EP023721HU | CusabioAlternative Name(s): FLJ60468; MGC1223; OTTHUMP00000214289; OTTHUMP00000214290; OTTHUMP00000214297; OTTHUMP00000214298; OTTHUMP00000214299; RP3-417M14.1; TM14B_HUMAN;...

Recombinant Human Transmembrane protein 141 (TMEM141) | CSB-EP023711HU | CusabioAlternative Name(s): D2Ertd217e; TM141_HUMAN; tmem141; Transmembrane protein 141Gene Names: TMEM141Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Transmembrane protein 132A (TMEM132A), partial | CSB-EP023699HU | CusabioAlternative Name(s): HSPA5-binding protein 1 HSPA5BP1, KIAA1583Gene Names: TMEM132AResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial | CSB-EP023606MOb1 | CusabioAlternative Name(s): Tlr7; Toll-like receptor 7Gene Names: Tlr7Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Toll-like receptor 7 (Tlr7), partial | CSB-EP023606MO | CusabioAlternative Name(s): Tlr7; Toll-like receptor 7Gene Names: Tlr7Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Toll-like receptor 7 (TLR7), partial | CSB-EP023606HU | CusabioAlternative Name(s): PRO285; TLR 7; Tlr7; TLR7_HUMAN; Toll like receptor 7; Toll-like receptor 7; UNQ248Gene Names: TLR7Research Areas: Epigenetics and Nuclear...

Recombinant Human Toll-like receptor 4 (TLR4), partial | CSB-EP023603HU1 | CusabioAlternative Name(s): hToll (CD_antigen: CD284)Gene Names: TLR4Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Toll-like receptor 2 (TLR2), partial | CSB-EP023601HU1 | CusabioAlternative Name(s): Toll/interleukin-1 receptor-like protein 4; CD282Gene Names: TLR2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Transketolase (TKT) | CSB-EP023580HU | CusabioAlternative Name(s): TKGene Names: TKTResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Thymidine kinase 2, mitochondrial (TK2) | CSB-EP023578HU | CusabioAlternative Name(s): Mt-TKGene Names: TK2Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human herpesvirus 1 Thymidine kinase (TK) | CSB-EP023577HWY | CusabioAlternative Name(s): TK; UL23; Thymidine kinase; EC 2.7.1.21Gene Names: TKResearch Areas: OthersOrganism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus...

Recombinant Dog Tight junction protein ZO-1 (TJP1), partial | CSB-EP023573DO | CusabioAlternative Name(s): Tight junction protein 1Zona occludens protein 1Zonula occludens protein 1Gene Names: TJP1Research Areas: OthersOrganism: Canis lupus familiaris...

Recombinant Human Toll/interleukin-1 receptor domain-containing adapter protein (TIRAP) | CSB-EP023570HU | CusabioAlternative Name(s): Adaptor protein Wyatt MyD88 adapter-like proteinGene Names: TIRAPResearch Areas: ImmunologyOrganism: Homo sapiens...

Recombinant Bovine Metalloproteinase inhibitor 4 (TIMP4) | CSB-EP023563BO | CusabioAlternative Name(s): Tissue inhibitor of metalloproteinases 4 ;TIMP-4Gene Names: TIMP4Research Areas: OthersOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial | CSB-EP023562HU1 | CusabioAlternative Name(s): Protein MIG-5Tissue inhibitor of metalloproteinases 3 ;TIMP-3Gene Names: TIMP3Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Metalloproteinase inhibitor 1 (Timp1) | CSB-EP023560MO | CusabioAlternative Name(s): Collagenase inhibitor 16C8 fibroblastErythroid-potentiating activity ;EPATPA-S1TPA-induced protein;Tissue inhibitor of metalloproteinases 1 ;TIMP-1Gene...

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim8 A (TIMM8A) | CSB-EP023557HU | CusabioAlternative Name(s): Deafness dystonia protein 1 X-linked deafness dystonia proteinGene Names: TIMM8AResearch Areas: Signal Transduction...

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim23 (TIMM23) | CSB-EP023553HU | CusabioAlternative Name(s): TIMM23; TIM23; Mitochondrial import inner membrane translocase subunit Tim23Gene Names: TIMM23Research Areas: Tags &...

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-B (TIMM17B) | CSB-EP023551HU | CusabioAlternative Name(s): DXS9822; Inner mitochondrial membrane preprotein translocase; JM3; Mitochondrial import inner membrane translocase...

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A (TIMM17A) | CSB-EP023550HU | CusabioAlternative Name(s): Inner membrane preprotein translocase Tim17aGene Names: TIMM17AResearch Areas: Signal Transduction Organism: Homo...

Recombinant Human TGFB1-induced anti-apoptotic factor 1 (TIAF1) | CSB-EP023528HU | CusabioAlternative Name(s): 12KDA TGF-beta-1-induced antiapoptotic factorGene Names: TIAF1Research Areas: Cell Biology Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Thy-1 membrane glycoprotein (Thy1) | CSB-EP023525MO | CusabioAlternative Name(s): Thy-1 antigen CD_antigen: CD90Gene Names: Thy1Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Thyroid hormone receptor beta (THRB) | CSB-EP023514HU | CusabioAlternative Name(s): Nuclear receptor subfamily 1 group A member 2c-erbA-2c-erbA-betaGene Names: THRBResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Thyroid hormone receptor alpha (THRA) | CSB-EP023510HUa0 | CusabioAlternative Name(s): Nuclear receptor subfamily 1 group A member 1 (V-erbA-related protein 7) (EAR-7) (c-erbA-1) (c-erbA-alpha) (EAR7) (ERBA1) (NR1A1) (THRA1) (THRA2)Gene...