E.coli Recombinant

Recombinant Human Replication protein A 32KDA subunit (RPA2), partial | CSB-EP020089HU1 | CusabioAlternative Name(s): Replication factor A protein 2 ;RF-A protein 2Replication protein A 34KDA subunit ;RP-A p34Gene Names: RPA2Research Areas: Epigenetics...

Recombinant Human Replication protein A 70kDa DNA-binding subunit (RPA1) | CSB-EP020088HU | CusabioAlternative Name(s): Replication factor A protein 1 ;RF-A protein 1Single-stranded DNA-binding proteinGene Names: RPA1Research Areas: Epigenetics and...

Recombinant Human Protein XRP2 (RP2) | CSB-EP020076HU | CusabioAlternative Name(s): RP2; Protein XRP2Gene Names: RP2Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nuclear receptor ROR-gamma (RORC) | CSB-EP020071HU | CusabioAlternative Name(s): Nuclear receptor RZR-gammaNuclear receptor subfamily 1 group F member 3RAR-related orphan receptor CRetinoid-related orphan receptor-gammaGene Names:...

Recombinant Human Nuclear receptor ROR-alpha (RORA) | CSB-EP020069HUa0 | CusabioAlternative Name(s): Nuclear receptor RZR-alpha (Nuclear receptor subfamily 1 group F member 1) (RAR-related orphan receptor A) (Retinoid-related orphan receptor-alpha)...

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial | CSB-EP020067HU | CusabioAlternative Name(s): Neurotrophic tyrosine kinase, receptor-related 1Gene Names: ROR1Research Areas: NeuroscienceOrganism: Homo...

Recombinant Human Ropporin-1B (ROPN1B), partial | CSB-EP020065HU | CusabioAlternative Name(s): Rhophilin-associated protein 1BGene Names: ROPN1BResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribonuclease inhibitor (RNH1) | CSB-EP019901HUb1 | CusabioAlternative Name(s): Placental ribonuclease inhibitor;Placental RNase inhibitor;Ribonuclease/angiogenin inhibitor 1;RAIGene Names: RNH1Research Areas: CardiovascularOrganism:...

Recombinant Human Ribonuclease inhibitor (RNH1) | CSB-EP019901HU | CusabioAlternative Name(s): Ribonuclease inhibitor(Placental ribonuclease inhibitor)(Placental RNase inhibitor)(Ribonuclease/angiogenin inhibitor 1)(RAI)Gene Names: RNH1Research Areas:...

Recombinant Human E3 ubiquitin-protein ligase RNF8 (RNF8) | CSB-EP019898HU | CusabioAlternative Name(s): RING finger protein 8 ?RING-type E3 ubiquitin transferase RNF8?Gene Names: RNF8Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RING-box protein 2 (RNF7) | CSB-EP019897HU | CusabioAlternative Name(s): CKII beta-binding protein 1 ;CKBBP1RING finger protein 7Regulator of cullins 2Sensitive to apoptosis gene proteinGene Names: RNF7Research Areas: Epigenetics and...

Recombinant Human ORC ubiquitin ligase 1 (OBI1), partial | CSB-EP019878HU1 | CusabioAlternative Name(s): RING finger protein 219Gene Names: OBI1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RING finger protein 212 (RNF212) | CSB-EP019872HU | CusabioAlternative Name(s): RING finger protein 212Gene Names: RNF212Research Areas: Epigenetics and Nuclear Signaling Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RING finger protein 114 (RNF114) | CSB-EP019821HU | CusabioAlternative Name(s): RING finger protein 114 Zinc finger protein 228 Zinc finger protein 313Gene Names: RNF114Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo...

Recombinant Human Ribonuclease H1 (RNASEH1) | CSB-EP019801HU | CusabioAlternative Name(s): Ribonuclease H type II RNH1Gene Names: RNASEH1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribonuclease 4 (RNASE4) | CSB-EP019796HU | CusabioAlternative Name(s): RNS4Gene Names: RNASE4Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Non-secretory ribonuclease (RNASE2) | CSB-EP019794HU | CusabioAlternative Name(s): Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 ;RNase 2Ribonuclease USGene Names: RNASE2Research Areas: ImmunologyOrganism: Homo sapiens...

Recombinant Human Receptor-interacting serine/threonine-protein kinase 2 (RIPK2) | CSB-EP019736HU | CusabioAlternative Name(s): CARD-containing interleukin-1 beta-converting enzyme-associated kinase ;CARD-containing IL-1 beta...

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG) | CSB-EP019690HU | CusabioAlternative Name(s): Rho-related GTP-binding protein RhoGGene Names: RHOGResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Rho-related GTP-binding protein RhoD (RHOD) | CSB-EP019688HU | CusabioAlternative Name(s): Rho-related protein HP1Gene Names: RHODResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Pig Rhodopsin (RHO), partial | CSB-EP019681PI1e0 | CusabioAlternative Name(s): RHO1Gene Names: RHOResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQSource: E.coliTag Info: N-terminal...

Recombinant Pig Rhodopsin (RHO), partial | CSB-EP019681PI1 | CusabioAlternative Name(s): RHO1Gene Names: RHOResearch Areas: Signal TransductionOrganism: Sus scrofa (Pig)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQSource: E.coliTag Info: N-terminal...

Recombinant Human Rhodopsin (RHO), partial | CSB-EP019681HU | CusabioAlternative Name(s): Opsin-2Gene Names: RHOResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQSource: E.coliTag Info:...

Recombinant Bovine Rhodopsin (RHO), partial | CSB-EP019681BO1 | CusabioAlternative Name(s): RHO; RhodopsinGene Names: RHOResearch Areas: Signal TransductionOrganism: Bos taurus (Bovine)AA Sequence: MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQSource: E.coliTag...

Recombinant Human Blood group Rh (D) polypeptide (RHD), partial | CSB-EP019677HU | CusabioAlternative Name(s): RHXIII Rh polypeptide 2 Short name: RhPII Rhesus D antigen CD_antigen: CD240DGene Names: RHDResearch Areas: CardiovascularOrganism: Homo...

Recombinant Human Rhomboid-related protein 2 (RHBDL2), partial | CSB-EP019672HU | CusabioAlternative Name(s): Rhomboid-like protein 2Gene Names: RHBDL2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Regulator of G-protein signaling 7 (RGS7) | CSB-EP019659HU | CusabioAlternative Name(s): RGS7; Regulator of G-protein signaling 7; RGS7Gene Names: RGS7Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Regulator of G-protein signaling 5 (RGS5) | CSB-EP019657HU | CusabioAlternative Name(s): MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; Regulator of G Protein Signalling 5; Regulator of G-protein signaling 5; RGS 5; RGS5;...

Recombinant Human Regulator of G-protein signaling 20 (RGS20) | CSB-EP019652HU | CusabioAlternative Name(s): Gz-selective GTPase-activating proteinGene Names: RGS20Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Regulator of G-protein signaling 2 (RGS2) | CSB-EP019651HU | CusabioAlternative Name(s): Cell growth-inhibiting gene 31 protein;G0/G1 switch regulatory protein 8Gene Names: RGS2Research Areas: Signal TransductionOrganism: Homo sapiens...

Recombinant Human Regulator of G-protein signaling 10 (RGS10) | CSB-EP019642HU | CusabioAlternative Name(s): Regulator of G protein signaling 10; Regulator of G-protein signaling 10; RGS10; RGS10_HUMANGene Names: RGS10Research Areas: Signal...

Recombinant Rat Regucalcin (Rgn) | CSB-EP019630RA | CusabioAlternative Name(s): Gluconolactonase (EC:3.1.1.17) Short name: GNL Senescence marker protein 30 Short name: SMP-30 Smp30Gene Names: RgnResearch Areas: Signal TransductionOrganism: Rattus...

Recombinant Human Replication factor C subunit 1 (RFC1), partial | CSB-EP019588HU | CusabioAlternative Name(s): Activator 1 140KDA subunitGene Names: RFC1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Resistin (Retn) | CSB-EP019573MO | CusabioAlternative Name(s): Adipose tissue-specific secretory factor ;ADSFAdipose-specific cysteine-rich secreted protein A12-alpha;Cysteine-rich secreted protein FIZZ3Gene Names: RetnResearch Areas:...

Recombinant Human Resistin (RETN) | CSB-EP019573HU | CusabioAlternative Name(s): Adipose tissue-specific secretory factor ;ADSFC/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein;Cysteine-rich secreted protein A12-alpha-like...

Recombinant Bovine Resistin (RETN) | CSB-EP019573BOa2 | CusabioAlternative Name(s): RSTNGene Names: RETNResearch Areas: CardiovascularOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Bovine Resistin (RETN) | CSB-EP019573BO | CusabioAlternative Name(s): RETN; RSTN; ResistinGene Names: RETNResearch Areas: OthersOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Human Reelin (RELN), partial | CSB-EP019557HU | CusabioAlternative Name(s): LIS2; PRO1598; Reeler; Reelin; RELN; RELN_HUMAN; RLGene Names: RELNResearch Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Proto-oncogene c-Rel (REL), partial | CSB-EP019552HU | CusabioAlternative Name(s): Avian reticuloendotheliosis ; C REL; C Rel protein; c Rel proto oncogene protein; Oncogene REL ; Oncogene REL avian reticuloendotheliosis; Proto-oncogene...

Recombinant Rat Regenerating islet-derived protein 3-gamma (Reg3g) | CSB-EP019549RA | CusabioAlternative Name(s): Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ;Reg III-gammaGene Names: Reg3gResearch Areas: OthersOrganism:...

Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), partial | CSB-EP019549MO | CusabioAlternative Name(s): Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ;Reg III-gammaGene Names: Reg3gResearch Areas:...

Recombinant Rat Regenerating islet-derived protein 3-alpha (Reg3a) | CSB-EP019548RA | CusabioAlternative Name(s): Islet of Langerhans regenerating protein 3 ;REG 3Lithostathine 3;Pancreatitis-associated protein 2RegIIIRegenerating islet-derived protein...

Recombinant Human Regenerating islet-derived protein 3-alpha (REG3A) | CSB-EP019548HU | CusabioAlternative Name(s): Hepatointestinal pancreatic protein ;HIP/PAPHuman proislet peptidePancreatitis-associated protein 1Regenerating islet-derived protein...

Recombinant Human ATP-dependent DNA helicase Q1 (RECQL) | CSB-EP019537HU | CusabioAlternative Name(s): DNA helicase, RecQ-like type 1 Short name: RecQ1 DNA-dependent ATPase Q1 RecQ protein-like 1 RECQ1, RECQL1Gene Names: RECQLResearch Areas: Epigenetics...

Recombinant human Retinol dehydrogenase 11 (RDH11), partial | CSB-EP019523HU | CusabioAlternative Name(s): Androgen-regulated short-chain dehydrogenase/reductase 1HCV core-binding protein HCBP12;Prostate short-chain dehydrogenase/reductase 1Retinal...

Recombinant Human Recoverin (RCVRN) | CSB-EP019519HU | CusabioAlternative Name(s): Cancer-associated retinopathy protein ;Protein CARGene Names: RCVRNResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human E3 ubiquitin-protein ligase RBX1 (RBX1) | CSB-EP019496HU | CusabioAlternative Name(s): Protein ZYP RING finger protein 75 RING-box protein 1Gene Names: RBX1Research Areas: Cell Biology Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Bovine Retinol-binding protein 3 (RBP3), partial | CSB-EP019482BO | CusabioAlternative Name(s): Interphotoreceptor retinoid-binding protein ;IRBPInterstitial retinol-binding proteinGene Names: RBP3Research Areas: OthersOrganism: Bos taurus...

Recombinant Human Retinol-binding protein 2 (RBP2) | CSB-EP019481HU | CusabioAlternative Name(s): Cellular retinol-binding protein IIGene Names: RBP2Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human RNA-binding motif protein, X chromosome (RBMX), partial | CSB-EP019444HU1 | CusabioAlternative Name(s): Glycoprotein p43 (Heterogeneous nuclear ribonucleoprotein G) (hnRNP G) (HNRPG) (RBMXP1)Gene Names: RBMXResearch Areas: Epigenetics...

Recombinant Human RNA binding protein fox-1 homolog 2 (RBFOX2) | CSB-EP019439HU | CusabioAlternative Name(s): Fox-1 homolog BHexaribonucleotide-binding protein 2RNA-binding motif protein 9RNA-binding protein 9Repressor of tamoxifen transcriptional...

Recombinant Human Putative RNA-binding protein 3 (RBM3) | CSB-EP019420HU | CusabioAlternative Name(s): RNA-binding motif protein 3RNPLGene Names: RBM3Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ribokinase (RBKS), partial | CSB-EP019397HU | CusabioAlternative Name(s): RBKS; RBSK; Ribokinase; RK; EC 2.7.1.15Gene Names: RBKSResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Escherichia coli Ribokinase (rbsK) | CSB-EP019397ENV | CusabioAlternative Name(s): rbsK; b3752; JW3731; Ribokinase; RK; EC 2.7.1.15Gene Names: rbsKResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Human Ras GTPase-activating protein 1 (RASA1), partial | CSB-EP019346HU | CusabioAlternative Name(s): Ras p21 protein activator (p120GAP)Gene Names: RASA1Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rap-2b (RAP2B) | CSB-EP019327HU | CusabioAlternative Name(s): MGC20484; RAP 2B; RAP2A; Rap2b; RAP2B member of RAS oncogene family; RAP2B_HUMAN; Ras family small GTP binding protein RAP2B; Ras related protein RAP 2B;...

Recombinant Human E3 SUMO-protein ligase RanBP2 (RANBP2), partial | CSB-EP019311HU | CusabioAlternative Name(s): 358KDA nucleoporin Nuclear pore complex protein Nup358 Nucleoporin Nup358 Ran-binding protein 2Gene Names: RANBP2Research Areas:...

Recombinant Human GTP-binding nuclear protein Ran (RAN) | CSB-EP019307HU | CusabioAlternative Name(s): Androgen receptor-associated protein 24 GTPase Ran Ras-like protein TC4 Ras-related nuclear proteinGene Names: RANResearch Areas: Cell Biology...

Recombinant Human Ras-related protein Ral-B (RALB) | CSB-EP019297HU | CusabioAlternative Name(s): 5730472O18Rik; dRalb; GTP binding protein; Ralb; RALB_HUMAN; RAS like protein B; RAS like proto oncogene B; Ras related GTP binding protein B; Ras-related...

Recombinant Human RAF proto-oncogene serine/threonine-protein kinase (RAF1) | CSB-EP019284HU | CusabioAlternative Name(s): Proto-oncogene c-RAF ;cRafRaf-1Gene Names: RAF1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human mRNA export factor (RAE1) | CSB-EP019276HU | CusabioAlternative Name(s): Rae1 protein homolog mRNA-associated protein mrnp 41Gene Names: RAE1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human DNA repair protein RAD51 homolog 4 (RAD51D) | CSB-EP019268HU | CusabioAlternative Name(s): R51H3 RAD51 homolog D RAD51-like protein 3 TRADGene Names: RAD51L3Research Areas: Epigenetics and Nuclear Signaling Organism: Homo sapiens...

Recombinant Human UV excision repair protein RAD23 homolog A (RAD23A) (T131A) | CSB-EP019259HU(M) | CusabioAlternative Name(s): UV excision repair protein RAD23 homolog A(HR23A)(hHR23A)Gene Names: RAD23AResearch Areas: Epigenetics and Nuclear...

Recombinant Human UV excision repair protein RAD23 homolog A (RAD23A) | CSB-EP019259HU | CusabioAlternative Name(s): hHR 23A; hHR23A; HR23A; MGC111083; RAD 23a; RAD23 homolog A (S. cerevisiae); RAD23 homolog A; RAD23 yeast homolog A; RAD23A; RD23A_HUMAN;...

Recombinant Human Cell cycle checkpoint protein RAD1 (RAD1) | CSB-EP019252HU | CusabioAlternative Name(s): DNA repair exonuclease rad1 homolog Rad1-like DNA damage checkpoint proteinGene Names: RAD1Research Areas: Epigenetics and Nuclear Signaling...

Recombinant Human Ras-related C3 botulinum toxin substrate 3 (RAC3) | CSB-EP019249HU | CusabioAlternative Name(s): p21-Rac3Gene Names: RAC3Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rab-8A (RAB8A), partial | CSB-EP019222HU1 | CusabioAlternative Name(s): Oncogene c-melGene Names: RAB8AResearch Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rab-6A (RAB6A) | CSB-EP019216HU | CusabioAlternative Name(s): GTP binding protein RAB6A'; GTP binding protein RAB6B; Oncogene RAB6; Rab 6; Rab GTPase; Rab-6; RAB6; RAB6 member RAS oncogene family; RAB6A; RAB6A member...

Recombinant Human Ras-related protein Rab-5C (RAB5C) | CSB-EP019215HU | CusabioAlternative Name(s): L1880RAB5LGene Names: RAB5CResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rab-5B (RAB5B) | CSB-EP019214HU | CusabioAlternative Name(s): RAB5B; Ras-related protein Rab-5BGene Names: RAB5BResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rab-5A (RAB5A) | CSB-EP019213HU | CusabioAlternative Name(s): RAB 5; RAB 5A; RAB5A; RAB5A member RAS oncogene family; RAB5A_HUMAN; RAS associated protein RAB5A; Ras related protein Rab 5A; Ras-related protein...

Recombinant Human Ras-related protein Rab-4A (RAB4A) | CSB-EP019211HU | CusabioAlternative Name(s): HRES 1 / RAB4; Oncogene RAB4; Rab 4; RAB 4A; RAB4 member RAS oncogene family; Rab4a; RAB4A member RAS oncogene family; RAB4A_HUMAN; Ras related protein...

Recombinant Human Ras-related protein Rab-2A (RAB2A) | CSB-EP019180HU | CusabioAlternative Name(s): 9330148M11Rik; C80220; GTP binding protein; LHX; OTTMUSP00000004796; RAB2; RAB2 member RAS oncogene family; RAB2A; RAB2A; member RAS oncogene family;...

Recombinant Human Ras-related protein Rab-27B (RAB27B) | CSB-EP019178HU | CusabioAlternative Name(s): C25KGGene Names: RAB27BResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rab-1A (RAB1A) | CSB-EP019167HU | CusabioAlternative Name(s): YPT1-related proteinGene Names: RAB1AResearch Areas: TransportOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ras-related protein Rab-11A (RAB11A) | CSB-EP019153HU | CusabioAlternative Name(s): YL8Gene Names: RAB11AResearch Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Ras-related protein Rab-10 (Rab10) | CSB-EP019152MOa0 | CusabioAlternative Name(s): Rab10; Ras-related protein Rab-10Gene Names: Rab10Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Ras-related protein Rab-10 (Rab10) | CSB-EP019152MO | CusabioAlternative Name(s): Rab10; Ras-related protein Rab-10Gene Names: Rab10Research Areas: Signal Transduction Organism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Ras-related protein Rab-10 (RAB10), partial | CSB-EP019152HU | CusabioAlternative Name(s): GTP binding protein RAB10; Rab10; RAB10 member RAS oncogene family; RAB10_HUMAN; Ras related GTP binding protein; Ras related GTP binding protein...

Recombinant Mouse Glutaminyl-peptide cyclotransferase (Qpct) | CSB-EP019135MO | CusabioAlternative Name(s): Glutaminyl cyclase Short name:QC;Glutaminyl-tRNA cyclotransferaseGene Names: QpctResearch Areas: NeuroscienceOrganism: Mus musculus (Mouse)AA...

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT) | CSB-EP019135HU | CusabioAlternative Name(s): Glutaminyl cyclase ;QC ;sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase ;ECGene Names: QPCTResearch Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Pregnancy zone protein (PZP), partial | CSB-EP019131HU | CusabioAlternative Name(s): C3 and PZP-like alpha-2-macroglobulin domain-containing protein 6Gene Names: PZPResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Peptide YY (PYY), partial | CSB-EP019128HU1a0 | CusabioAlternative Name(s): PYY-IGene Names: PYY Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRYSource: E.coliTag Info: N-terminal...

Recombinant Human Peptide YY protein (PYY), partial | CSB-EP019128HU1 | CusabioAlternative Name(s): PYY-IGene Names: PYY Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence: IKPEAPREDASPEELNRYYASLRHYLNLVTRQRYSource: E.coliTag Info:...

Recombinant Human Glycogen phosphorylase, liver form (PYGL), partial | CSB-EP019122HU | CusabioAlternative Name(s): Glycogen phosphorylase; Glycogen phosphorylase L; Glycogen phosphorylase liver; Glycogen phosphorylase liver form; GSD6; Hers disease;...

Recombinant Human t Pyrroline-5-carboxylate reductase 1, mitochondrial (PYCR1) | CSB-EP019115HU | CusabioAlternative Name(s): /Gene Names: PYCR1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Poliovirus receptor (PVR), partial | CSB-EP019093HU | CusabioAlternative Name(s): Nectin-like protein 5 Short name: NECL-5 CD_antigen: CD155Gene Names: PVRResearch Areas: MicrobiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Parvalbumin alpha (PVALB) | CSB-EP019092HU | CusabioAlternative Name(s): D22S749; MGC116759; Parvalbumin alpha; PRVA_HUMAN; PVALBGene Names: PVALBResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), partial | CSB-EP019068HUa0 | CusabioAlternative Name(s): Protein-tyrosine phosphatase receptor type Z polypeptide 1 (Protein-tyrosine phosphatase receptor type Z polypeptide...

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta (PTPRZ1), Partial | CSB-EP019068HU | CusabioAlternative Name(s): Protein-tyrosine phosphatase receptor type Z polypeptide 1;Protein-tyrosine phosphatase receptor type Z polypeptide...

Recombinant Mouse Receptor-type tyrosine-protein phosphatase S (Ptprs), partial | CSB-EP019064MO | CusabioAlternative Name(s): PTPNU-3 Receptor-type tyrosine-protein phosphatase sigmaGene Names: PtprsResearch Areas: NeuroscienceOrganism: Mus musculus...

Recombinant Human Receptor-type tyrosine-protein phosphatase C (PTPRC), partial | CSB-EP019049HU | CusabioAlternative Name(s): Leukocyte common antigenGene Names: PTPRCResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Receptor-type tyrosine-protein phosphatase beta (PTPRB), partial | CSB-EP019048HU | CusabioAlternative Name(s): Vascular endothelial protein tyrosine phosphatase ;VE-PTPGene Names: PTPRBResearch Areas: Signal TransductionOrganism: Homo...

Recombinant Human Tyrosine-protein phosphatase non-receptor type 6 (PTPN6) | CSB-EP019043HU | CusabioAlternative Name(s): Hematopoietic cell protein-tyrosine phosphataseProtein-tyrosine phosphatase 1C ;PTP-1CProtein-tyrosine phosphatase SHP-1SH-PTP1Gene...

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial | CSB-EP019042HU | CusabioAlternative Name(s): Neural-specific protein-tyrosine phosphatase;Striatum-enriched protein-tyrosine phosphatase ;STEPGene Names: PTPN5Research...

Recombinant Human Tyrosine-protein phosphatase non-receptor type 1 (PTPN1), partial | CSB-EP019024HU1 | CusabioAlternative Name(s): Protein-tyrosine phosphatase 1B (PTP-1B) (PTP1B)Gene Names: PTPN1Research Areas: Signal TransductionOrganism: Homo sapiens...

Recombinant Human Parathymosin (PTMS) | CSB-EP019008HU | CusabioAlternative Name(s): Gene Names: PTMSResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Parathyroid hormone-related protein (PTHLH), partial | CSB-EP018991HU | CusabioAlternative Name(s): Parathyroid hormone-like protein ;PLPGene Names: PTHLHResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Parathyroid hormone 2 receptor (PTH2R), partial | CSB-EP018990HU | CusabioAlternative Name(s): Parathyroid hormone 2 receptor; Parathyroid hormone receptor precursor ; PTH 2 receptor ; PTH2 receptor; Pth2r; PTH2R_HUMAN; Pthr 2;...

Recombinant Rat Parathyroid hormone (Pth) | CSB-EP018987RA | CusabioAlternative Name(s): ParathyrinGene Names: PthResearch Areas: Signal TransductionOrganism: Rattus norvegicus (Rat)AA Sequence:...