E.coli Recombinant

Recombinant Human Pro-neuregulin-3, membrane-bound isoform (NRG3), partial | CSB-EP016079HU | CusabioAlternative Name(s): Pro-NRG3Gene Names: NRG3Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Pro-neuregulin-2, membrane-bound isoform (NRG2), partial | CSB-EP016078HU | CusabioAlternative Name(s): Divergent of neuregulin-1 ;DON-1Neural- and thymus-derived activator for ERBB kinases ;NTAKGene Names: NRG2Research Areas:...

Recombinant Human Pro-neuregulin-1, membrane-bound isoform (NRG1), partial | CSB-EP016077HU1 | CusabioAlternative Name(s): Neuregulin 1Gene Names: NRG1Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Nuclear respiratory factor 1 (Nrf1) | CSB-EP016076MO | CusabioAlternative Name(s): Nuclear respiratory factor 1 Short name: NRF-1 Alternative name(s): Alpha palindromic-binding protein Short name: Alpha-palGene Names: Nrf1Research...

Recombinant Human GTPase NRas (NRAS) | CSB-EP016070HU | CusabioAlternative Name(s): Transforming protein N-RasGene Names: NRASResearch Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Nuclear receptor subfamily 5 group A member 2 (Nr5a2) | CSB-EP016066MO | CusabioAlternative Name(s): Liver receptor homolog 1 (LRH-1) (Lrh1)Gene Names: Nr5a2Research Areas: Developmental BiologyOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1c2 | CusabioAlternative Name(s): Nuclear receptor subfamily 3 group C member 1 GRLGene Names: NR3C1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human Glucocorticoid receptor (NR3C1), partial | CSB-EP016059HU1 | CusabioAlternative Name(s): Nuclear receptor subfamily 3 group C member 1 GRLGene Names: NR3C1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Nuclear receptor subfamily 2 group F member 6 (Nr2f6) | CSB-EP016058MO | CusabioAlternative Name(s): COUP transcription factor 3 (COUP-TF3) (V-erbA-related protein 2) (EAR-2) (Ear-2) (Ear2) (Erbal2)Gene Names: Nr2f6Research Areas:...

Recombinant Human Nuclear receptor subfamily 2 group F member 6 (NR2F6) | CSB-EP016058HU | CusabioAlternative Name(s): V-erbA-related protein 2 Short name: EAR-2Gene Names: NR2F6Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human Nuclear receptor subfamily 2 group C member 2 (Nr2c2), partial | CSB-EP016052HU1 | CusabioAlternative Name(s): Orphan nuclear receptor TAK1Orphan nuclear receptor TR4Testicular receptor 4Gene Names: Nr2c2Research Areas: Developmental...

Recombinant Human Nuclear receptor subfamily 1 group I member 2 (NR1I2) | CSB-EP016048HU | CusabioAlternative Name(s): Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR Pregnane X receptor Steroid and xenobiotic receptorGene Names: NR1I2Research...

Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r), partial | CSB-EP016036MO1b0 | CusabioAlternative Name(s): NPY-Y2 receptor (Y2 receptor)Gene Names: Npy2rResearch Areas: CardiovascularOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r), partial | CSB-EP016036MO1 | CusabioAlternative Name(s): NPY-Y2 receptor (Y2 receptor)Gene Names: Npy2rResearch Areas: CardiovascularOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Atrial natriuretic peptide receptor 3 (Npr3), partial | CSB-EP016025RA1 | CusabioAlternative Name(s): Atrial natriuretic peptide clearance receptorAtrial natriuretic peptide receptor type C ;ANP-C ;ANPR-C ;NPR-CGene Names: Npr3Research...

Recombinant Human Atrial natriuretic peptide receptor 3 (NPR3), partial | CSB-EP016025HU1 | CusabioAlternative Name(s): Atrial natriuretic peptide clearance receptor (Atrial natriuretic peptide receptor type C) (ANP-C) (ANPR-C) (NPR-C) (ANPRC) (C5orf23)...

Recombinant Human Atrial natriuretic peptide receptor 2 (NPR2), partial | CSB-EP016024HUa0 | CusabioAlternative Name(s): Atrial natriuretic peptide receptor type B (ANP-B) (ANPR-B) (NPR-B) (Guanylate cyclase B) (GC-B) (ANPRB)Gene Names: NPR2Research...

Recombinant Human Atrial natriuretic peptide receptor 2 (NPR2), partial | CSB-EP016024HU | CusabioAlternative Name(s): Atrial natriuretic peptide receptor type B ;ANP-B ;ANPR-B ;NPR-BGuanylate cyclase B ;GC-BGene Names: NPR2Research Areas:...

Recombinant Human Atrial natriuretic peptide receptor 1 (NPR1), partial | CSB-EP016023HUi8 | CusabioAlternative Name(s): Atrial natriuretic peptide receptor type A ;ANP-A ;ANPR-A ;NPR-AGuanylate cyclase A ;GC-AGene Names: NPR1Research Areas:...

Recombinant Human Atrial natriuretic peptide receptor 1 (NPR1), partial | CSB-EP016023HUc7 | CusabioAlternative Name(s): Atrial natriuretic peptide receptor type A (ANP-A) (ANPR-A) (NPR-A) (Guanylate cyclase A) (GC-A)Gene Names: NPR1Research Areas:...

Recombinant Human Atrial natriuretic peptide receptor 1 (NPR1), partial | CSB-EP016023HU | CusabioAlternative Name(s): Atrial natriuretic peptide receptor type A ;ANP-A ;ANPR-A ;NPR-AGuanylate cyclase A ;GC-AGene Names: NPR1Research Areas:...

Recombinant Human natriuretic peptide B (NPPB), partial | CSB-EP016021HU(A5) | CusabioAlternative Name(s): Gamma-brain natriuretic peptideGene Names: NPPBResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nephrin (NPHS1) , partial | CSB-EP015988HU | CusabioAlternative Name(s): Renal glomerulus-specific cell adhesion receptorGene Names: NPHS1Research Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nephrocystin-1 (NPHP1), partial | CSB-EP015985HU | CusabioAlternative Name(s): Juvenile nephronophthisis 1 proteinGene Names: NPHP1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Pro-FMRFamide-related neuropeptide FF (NPFF), partial | CSB-EP015981HU | CusabioAlternative Name(s): FMRFamide-related peptidesGene Names: NPFFResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence: SQAFLFQPQRFSource: E...

Recombinant Human Puromycin-sensitive aminopeptidase (NPEPPS), partial | CSB-EP015980HU | CusabioAlternative Name(s): Cytosol alanyl aminopeptidase (AAP-S) (PSA)Gene Names: NPEPPSResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neuropeptide B (NPB) | CSB-EP015971HUe1 | CusabioAlternative Name(s): Preproprotein L7 (hPPL7) (NPB23) (hL7) (hL7) (hL7C) (PPL7) (PPNPB)Gene Names: NPBResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neuropeptide B (NPB) | CSB-EP015971HU | CusabioAlternative Name(s): Preproprotein L7 (NPB23) (hL7) (NPB29) (hL7C)Gene Names: NPBResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence: WYKPAAGHSSYSVGRAAGLLSGLRRSPYASource: E...

Recombinant Rat NADPH oxidase 4 (Nox4), partial | CSB-EP015961RA | CusabioAlternative Name(s): Kidney oxidase-1Gene Names: Nox4Research Areas: CardiovascularOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human NADPH oxidase 4 (NOX4), partial | CSB-EP015961HU1 | CusabioAlternative Name(s): Kidney oxidase-1 Short name: KOX-1 Kidney superoxide-producing NADPH oxidase Renal NAD(P)H-oxidase RENOXGene Names: NOX4Research Areas:...

Recombinant Human Nucleolar protein 3 (NOL3) | CSB-EP015921HU | CusabioAlternative Name(s): Apoptosis repressor with CARD1 Gene Names: NOL3Research Areas: ApoptosisOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Noggin (NOG) | CSB-EP015917HU | CusabioAlternative Name(s): Gene Names: NOGResearch Areas: Developmental BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nicotinamide N-methyltransferase (NNMT) | CSB-EP015906HU | CusabioAlternative Name(s): EC 2.1.1.1; Nicotinamide N methyltransferase; Nicotinamide N-methyltransferase; NNMT; NNMT_HUMANGene Names: NNMTResearch Areas: Signal Transduction...

Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1) | CSB-EP015889SVGb1 | CusabioAlternative Name(s): NDK1, YNKGene Names: YNK1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)AA...

Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1) | CSB-EP015889SVGa0 | CusabioAlternative Name(s): NDK (NDP kinase) (NDK1) (YNK)Gene Names: YNK1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)...

Recombinant Saccharomyces cerevisiae Nucleoside diphosphate kinase (YNK1) | CSB-EP015889SVG | CusabioAlternative Name(s): NDK1, YNKGene Names: YNK1Research Areas: OthersOrganism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)AA...

Recombinant Human Nucleoside diphosphate kinase, mitochondrial (NME4) | CSB-EP015889HU | CusabioAlternative Name(s): Nucleoside diphosphate kinase DGene Names: NME4Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nucleoside diphosphate kinase B (NME2), partial | CSB-EP015886HU | CusabioAlternative Name(s): C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC:2.7.13.3)) (nm23-H2) (NM23B)Gene Names: NME2Research Areas:...

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2) | CSB-EP015849MOe1 | CusabioAlternative Name(s): Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog BGene Names: Nkx3-2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2) | CSB-EP015849MOb2 | CusabioAlternative Name(s): Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog BGene Names: Nkx3-2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Mouse Homeobox protein Nkx-3.2 (Nkx3-2) | CSB-EP015849MOb1 | CusabioAlternative Name(s): Bagpipe homeobox protein homolog 1 Homeobox protein NK-3 homolog BGene Names: Nkx3-2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Mouse Homeobox protein Nkx-2.2 (Nkx2-2) | CSB-EP015842MO | CusabioAlternative Name(s): Homeobox protein NK-2 homolog BGene Names: Nkx2-2 Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Homeobox protein Nkx-2.1 (NKX2-1) | CSB-EP015841HU | CusabioAlternative Name(s): Homeobox protein NK-2 homolog A (Thyroid nuclear factor 1) (Thyroid transcription factor 1) (TTF-1) (Thyroid-specific enhancer-binding protein) (T/EBP)...

Recombinant Human NK-tumor recognition protein (NKTR), partial | CSB-EP015838HU | CusabioAlternative Name(s): Natural-killer cells cyclophilin-related protein 1 domains:Putative peptidyl-prolyl cis-trans isomerase (EC:5.2.1.8) ;PPIase ;RotamaseGene...

Recombinant Human NF-kappa-B-repressing factor (NKRF), partial | CSB-EP015836HU | CusabioAlternative Name(s): Protein ITBA4Transcription factor NRFGene Names: NKRFResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Nidogen-1 (Nid1), partial | CSB-EP015802MO | CusabioAlternative Name(s): EntactinGene Names: Nid1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Protein BEX3 (NGFRAP1) | CSB-EP015781HU | CusabioAlternative Name(s): Brain-expressed X-linked protein 3Nerve growth factor receptor-associated protein 1Ovarian granulosa cell 13.0KDA protein HGR74p75NTR-associated cell death...

Recombinant Human Neuroglobin (NGB) | CSB-EP015776HU | CusabioAlternative Name(s): Neuroglobin; NGB; NGB_HUMANGene Names: NGBResearch Areas: TransportOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nuclear transcription factor Y subunit beta (NFYB) | CSB-EP015774HU | CusabioAlternative Name(s): CAAT box DNA-binding protein subunit B Nuclear transcription factor Y subunit BGene Names: NFYBResearch Areas: Signal Transduction...

Recombinant Human Neurofascin (NFASC), partial | CSB-EP015743HU | CusabioAlternative Name(s): KIAA0756; Neurofascin; Neurofascin homolog; NF; Nfasc; NFASC_HUMAN; NRCAMLGene Names: NFASCResearch Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Merlin (Nf2), partial | CSB-EP015741MO1 | CusabioAlternative Name(s): Moesin-ezrin-radixin-like protein (Neurofibromin-2) (Schwannomin) (Nf-2)Gene Names: Nf2Research Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Merlin (NF2) | CSB-EP015741HU | CusabioAlternative Name(s): Moesin-ezrin-radixin-like protein Neurofibromin-2 Schwannomerlin Schwannomin SCHGene Names: NF2Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Sialidase-1 (Neu1) | CSB-EP015717MO | CusabioAlternative Name(s): G9 sialidase (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1) (Neu)Gene Names: Neu1Research Areas: MicrobiologyOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human Neurofilament medium polypeptide (NEFM), partial | CSB-EP015691HU | CusabioAlternative Name(s): 160 kDa neurofilament protein (Neurofilament 3) (Neurofilament triplet) (M protein) (NEF3) (NFM)Gene Names: NEFMResearch Areas:...

Recombinant Rat Neurofilament light polypeptide (Nefl) | CSB-EP015688RA | CusabioAlternative Name(s): 68 kDa neurofilament protein (Neurofilament triplet L protein) (Nf68) (Nfl) (NF-L)Gene Names: NeflResearch Areas: NeuroscienceOrganism: Rattus...

Recombinant Human Neurofilament light polypeptide (NEFL) | CSB-EP015688HU | CusabioAlternative Name(s): 68KDA neurofilament protein Neurofilament triplet L proteinGene Names: NEFLResearch Areas: OthersOrganism: Homo sapiens (Human) AA Sequence:...

Recombinant Human Neurofilament heavy polypeptide (NEFH), partial | CSB-EP015686HU | CusabioAlternative Name(s): 200KDA neurofilament protein Neurofilament triplet H proteinGene Names: NEFHResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA...

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial (NDUFB5), partial | CSB-EP015652HU | CusabioAlternative Name(s): Complex I-SGDH ;CI-SGDHNADH-ubiquinone oxidoreductase SGDH subunitGene Names: NDUFB5Research...

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 (NDUFB10) | CSB-EP015642HU | CusabioAlternative Name(s): Complex I-PDSWGene Names: NDUFB10Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Staphylococcus aureus Acyl carrier protein (acpP) | CSB-EP015636SKXe0 | CusabioAlternative Name(s): acpP; hmrB; SAV1232Acyl carrier protein; ACPGene Names: acpPResearch Areas: OthersOrganism: Staphylococcus aureus (strain Mu50 / ATCC...

Recombinant Staphylococcus aureus Acyl carrier protein (acpP) | CSB-EP015636SKX | CusabioAlternative Name(s): hmrBGene Names: acpPResearch Areas: OthersOrganism: Staphylococcus aureus (strain Mu50 / ATCC 700699)AA Sequence:...

Recombinant Escherichia coli Acyl carrier protein (acpP) | CSB-EP015636ENV | CusabioAlternative Name(s): Cytosolic-activating factorGene Names: acpPResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (NDUFA6) , partial | CSB-EP015631HU | CusabioAlternative Name(s): Complex I-B14 ;CI-B14LYR motif-containing protein 6NADH-ubiquinone oxidoreductase B14 subunitGene Names:...

Recombinant Human NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 (NDUFA3) | CSB-EP015624HU | CusabioAlternative Name(s): Complex I-B9 ;CI-B9NADH-ubiquinone oxidoreductase B9 subunitGene Names: NDUFA3Research Areas: TransportOrganism: Homo...

Recombinant Human Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 (NDST1), partial | CSB-EP015614HU | CusabioAlternative Name(s): Glucosaminyl N-deacetylase/N-sulfotransferase 1 ;NDST-1N-heparan sulfate sulfotransferase 1 ;N-HSST...

Recombinant Human Norrin (Ndp) | CSB-EP015609HU | CusabioAlternative Name(s): Norrin(Norrie disease protein)(X-linked exudative vitreoretinopathy 2 protein)Gene Names: NdpResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Cytoplasmic domain protein NCK2 (NCK2) | CSB-EP015531HU | CusabioAlternative Name(s): Growth factor receptor-bound protein 4NCK adaptor protein 2 ;Nck-2SH2/SH3 adaptor protein NCK-betaGene Names: NCK2Research Areas:...

Recombinant Human Nuclear cap-binding protein subunit 2 (NCBP2) | CSB-EP015521HU | CusabioAlternative Name(s): 20KDA nuclear cap-binding protein Cell proliferation-inducing gene 55 protein NCBP 20KDA subunitGene Names: NCBP2Research Areas: Epigenetics...

Recombinant Rat Neural cell adhesion molecule 1 (Ncam1), partial | CSB-EP015511RA | CusabioAlternative Name(s): CD_antigen: CD56Gene Names: Ncam1Research Areas: NeuroscienceOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Neural cell adhesion molecule 1 (NCAM1), partial | CSB-EP015511HU1 | CusabioAlternative Name(s): CD_antigen: CD56 NCAMGene Names: NCAM1Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neurocalcin-delta (NCALD) | CSB-EP015510HU | CusabioAlternative Name(s): NCALD; Neurocalcin-deltaGene Names: NCALDResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Neuron navigator 3 (Nav3), partial | CSB-EP015480MO | CusabioAlternative Name(s): Neuron navigator 3(Pore membrane and/or filament-interacting-like protein 1)Gene Names: Nav3Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Human Neuron navigator 1 (NAV1), partial | CSB-EP015478HU2 | CusabioAlternative Name(s): Pore membrane and/or filament-interacting-like protein 3 Steerin-1 Unc-53 homolog 1Gene Names: NAV1Research Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Neuron navigator 1 (NAV1), partial | CSB-EP015478HU1 | CusabioAlternative Name(s): Pore membrane and/or filament-interacting-like protein 3 Steerin-1 Unc-53 homolog 1Gene Names: NAV1Research Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Arylamine N-acetyltransferase 2 (NAT2) | CSB-EP015471HU | CusabioAlternative Name(s): Arylamide acetylase 2 N-acetyltransferase type 2 Short name: NAT-2 Polymorphic arylamine N-acetyltransferase Short name: PNATGene Names: NAT2Research...

Recombinant Human Napsin-A (NAPSA) | CSB-EP015452HU | CusabioAlternative Name(s): Aspartyl protease 4 ;ASP4 ;Asp 4Napsin-1TA01/TA02Gene Names: NAPSAResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Nicotinate phosphoribosyltransferase (NAPRT), partial | CSB-EP015451HU | CusabioAlternative Name(s): FHA-HIT-interacting proteinNicotinate phosphoribosyltransferase domain-containing protein 1Gene Names: NAPRT1Research Areas:...

Recombinant Human Nucleosome assembly protein 1-like 4 (NAP1L4) | CSB-EP015444HU | CusabioAlternative Name(s): Nucleosome assembly protein 1-like 4(Nucleosome assembly protein 2)(NAP-2)Gene Names: NAP1L4Research Areas: Epigenetics and Nuclear...

Recombinant Human Nanos homolog 2 (NANOS2) | CSB-EP015437HU | CusabioAlternative Name(s): NANO2_HUMAN; Nanos homolog 2; Nanos homolog 2 Drosophila; NANOS2; NOS-2; NOS2Gene Names: NANOS2Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo...

Recombinant Mouse Nicotinamide phosphoribosyltransferase (Nampt) | CSB-EP015422MOe1 | CusabioAlternative Name(s): Pre-B-cell colony-enhancing factor 1 homolog Short name: PBEF VisfatinGene Names: NamptResearch Areas: BiochemicalsOrganism: Mus musculus...

Recombinant Mouse Nicotinamide phosphoribosyltransferase (Nampt) (C39S) | CSB-EP015422MO(M1) | CusabioAlternative Name(s): Pre-B-cell colony-enhancing factor 1 homolog Short name: PBEF VisfatinGene Names: NamptResearch Areas: BiochemicalsOrganism: Mus...

Recombinant Mouse Nicotinamide phosphoribosyltransferase (Nampt) | CSB-EP015422MO | CusabioAlternative Name(s): Pre-B-cell colony-enhancing factor 1 homolog Short name: PBEF VisfatinGene Names: NamptResearch Areas: BiochemicalsOrganism: Mus musculus...

Recombinant Mouse Myocilin (Myoc), partial | CSB-EP015356MO | CusabioAlternative Name(s): Trabecular meshwork-induced glucocorticoid response proteinGene Names: MyocResearch Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus (Mouse)AA...

Recombinant Human Myosin light chain 3 (MYL3) | CSB-EP015310HU | CusabioAlternative Name(s): Cardiac myosin light chain 1Gene Names: MYL3Research Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Myosin light chain 1/3, skeletal muscle isoform (MYL1) | CSB-EP015305HU | CusabioAlternative Name(s): Myosin light chain alkali 1/2Gene Names: MYL1Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Myosin-9 (MYH9) , partial | CSB-EP015303HUe0 | CusabioAlternative Name(s): Cellular myosin heavy chain, type AMyosin heavy chain 9Myosin heavy chain, non-muscle IIaNon-muscle myosin heavy chain A ;NMMHC-ANon-muscle myosin heavy chain...

Recombinant Human Myosin-6 (MYH6), partial | CSB-EP015299HU | CusabioAlternative Name(s): Myosin heavy chain 6 Myosin heavy chain, cardiac muscle alpha isoformGene Names: MYH6Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Myelin expression factor 2 (MYEF2), partial | CSB-EP015283HU | CusabioAlternative Name(s): MST156Gene Names: MYEF2Research Areas: TranscriptionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Myc proto-oncogene protein (Myc) | CSB-EP015270MO | CusabioAlternative Name(s): Proto-oncogene c-MycTranscription factor p64Gene Names: MycResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Myc proto-oncogene protein (MYC), partial | CSB-EP015270HU1 | CusabioAlternative Name(s): Class E basic helix-loop-helix protein 39 (bHLHe39) (Proto-oncogene c-Myc) (Transcription factor p64) (BHLHE39)Gene Names: MYCResearch Areas:...

Recombinant Human Myc proto-oncogene protein (MYC) | CSB-EP015270HU | CusabioAlternative Name(s): Class E basic helix-loop-helix protein 39 ;bHLHe39Proto-oncogene c-MycTranscription factor p64Gene Names: MYCResearch Areas: TranscriptionOrganism: Homo...

Recombinant Human Major vault protein (MVP) | CSB-EP015248HU | CusabioAlternative Name(s): Lung resistance-related proteinGene Names: MVPResearch Areas: TransportOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Methylmalonyl-CoA mutase, mitochondrial (Mutc) | CSB-EP015243MO | CusabioAlternative Name(s): Methylmalonyl-CoA isomeraseGene Names: MutResearch Areas: MetabolismOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Methylmalonyl-CoA mutase, mitochondrial (MMUT) | CSB-EP015243HU | CusabioAlternative Name(s): Methylmalonyl-CoA isomeraseGene Names: MMUTResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Muscle, skeletal receptor tyrosine-protein kinase (MUSK), partial | CSB-EP015241HU | CusabioAlternative Name(s): Muscle-specific tyrosine-protein kinase receptor ;MuSK ;Muscle-specific kinase receptorGene Names: MUSKResearch Areas:...

Recombinant Human Mucin-2 (MUC2), partial | CSB-EP015222HUa0 | CusabioAlternative Name(s): Intestinal mucin-2 (MUC-2) (SMUC)Gene Names: MUC2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Mucin-2 (MUC2), partial | CSB-EP015222HU | CusabioAlternative Name(s): Intestinal mucin-2Gene Names: MUC2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Metaxin-2 (MTX2) | CSB-EP015213HU | CusabioAlternative Name(s): Mitochondrial outer membrane import complex protein 2Gene Names: MTX2Research Areas: Tags & Cell MarkersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 5-formyltetrahydrofolate cyclo-ligase (MTHFS) | CSB-EP015159HU | CusabioAlternative Name(s): 5,10-methenyl-tetrahydrofolate synthetase ;MTHFS ;Methenyl-THF synthetaseGene Names: MTHFSResearch Areas: MetabolismOrganism: Homo sapiens...

Recombinant Human Methylenetetrahydrofolate reductase (MTHFR) | CSB-EP015158HU | CusabioAlternative Name(s): 5 10 methylenetetrahydrofolate reductase (NADPH); 5 10 methylenetetrahydrofolate reductase; Methylenetetrahydrofolate reductase (NAD(P)H);...