E.coli Recombinant

Recombinant Human Keratin, type I cuticular Ha4 (KRT34) | CSB-EP012550HU | CusabioAlternative Name(s): Hair keratin, type I Ha4 Keratin-34 Short name: K34Gene Names: KRT34Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Keratin, type I cytoskeletal 19 (KRT19) | CSB-EP012534HU | CusabioAlternative Name(s): Cytokeratin-19 (CK-19) (Keratin-19) (K19)Gene Names: KRT19Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Keratin, type I cytoskeletal 18 (KRT18) | CSB-EP012519HUe1 | CusabioAlternative Name(s): Cell proliferation-inducing gene 46 protein (Cytokeratin-18) (CK-18) (Keratin-18) (K18) (CYK18)Gene Names: KRT18Research Areas: Signal...

Recombinant Human KeRatin, type I cytoskeletal 18 (KRT18), partial | CSB-EP012519HU2 | CusabioAlternative Name(s): Cell proliferation-inducing gene 46 protein;Cytokeratin-18 ;CK-18Keratin-18 ;K18Gene Names: KRT18Research Areas: Cell CycleOrganism: Homo...

Recombinant Human KeRatin, type I cytoskeletal 18 (KRT18), partial | CSB-EP012519HU1 | CusabioAlternative Name(s): Cell proliferation-inducing gene 46 protein;Cytokeratin-18 ;CK-18Keratin-18 ;K18Gene Names: KRT18Research Areas: Cell CycleOrganism: Homo...

Recombinant Human Keratin, type I cytoskeletal 18 (KRT18) | CSB-EP012519HU | CusabioAlternative Name(s): Cell proliferation-inducing gene 46 protein (Cytokeratin-18) (CK-18) (Keratin-18) (K18) (CYK18)Gene Names: KRT18Research Areas: Signal...

Recombinant Bovine Keratin, type I cytoskeletal 17 (KRT17) | CSB-EP012516BO | CusabioAlternative Name(s): Cytokeratin-17 ;CK-17Keratin-17 ;K17Gene Names: KRT17Research Areas: OthersOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Human Keratin, type I cytoskeletal 14 (KRT14) | CSB-EP012512HU | CusabioAlternative Name(s): Cytokeratin-14 ;CK-14Keratin-14 ;K14Gene Names: KRT14Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Keratin, type I cytoskeletal 10 (KRT10) | CSB-EP012504HU | CusabioAlternative Name(s): Cytokeratin-10 ;CK-10Keratin-10 ;K10Gene Names: KRT10Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Keratin, type II cytoskeletal 1 (KRT1) | CSB-EP012503HU | CusabioAlternative Name(s): 67 kDa cytokeratin Cytokeratin-1 Short name: CK-1 Hair alpha protein Keratin-1 Short name: K1 Type-II keratin Kb1 KRTAGene Names: KRT1Research Areas:...

Recombinant Human GTPase KRas (KRAS), partial | CSB-EP012493HU1 | CusabioAlternative Name(s): K-Ras 2Ki-Rasc-K-rasc-Ki-rasGene Names: KRASResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Importin subunit beta-1 (Kpnb1) | CSB-EP012490MO | CusabioAlternative Name(s): Karyopherin subunit beta-1Nuclear factor p97Pore targeting complex 97KDA subunit ;PTAC97SCGGene Names: Kpnb1Research Areas: OthersOrganism: Mus musculus...

Recombinant Human Importin subunit alpha-5 (KPNA1), partial | CSB-EP012483HU1 | CusabioAlternative Name(s): Karyopherin subunit alpha-2RAG cohort protein 1SRP1-alphaGene Names: KPNA1Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Kynurenine 3-monooxygenase (Kmo), partial | CSB-EP012475RA | CusabioAlternative Name(s): Kynurenine 3-hydroxylaseGene Names: KmoResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Kynurenine 3-monooxygenase (KMO) | CSB-EP012475HUb0 | CusabioAlternative Name(s): Kynurenine 3-hydroxylaseGene Names: KMOResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kynurenine 3-monooxygenase (KMO) | CSB-EP012475HUa0 | CusabioAlternative Name(s): Kynurenine 3-hydroxylaseGene Names: KMOResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kynurenine 3-monooxygenase (KMO) | CSB-EP012475HU | CusabioAlternative Name(s): Kynurenine 3-hydroxylase Gene Names: KMOResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial | CSB-EP012467HU | CusabioAlternative Name(s): CD159 antigen-like family member CNK cell receptor CNKG2-C-activating NK receptor; CD159cGene Names: KLRC2Research Areas:...

Recombinant Rat Plasma kallikrein (Klkb1), partial | CSB-EP012461RA | CusabioAlternative Name(s): Fletcher factorKininogenin;Plasma prekallikreinGene Names: Klkb1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Glandular kallikrein-7, submandibular/renal (Klk7) | CSB-EP012458RA | CusabioAlternative Name(s): Esterase BKallikrein-related protein K1;Proteinase ARSKG-7Tissue kallikreinGene Names: Klk7Research Areas: OthersOrganism: Rattus norvegicus...

Recombinant Human Kallikrein-7 (KLK7), partial | CSB-EP012458HU | CusabioAlternative Name(s): Serine protease 6Stratum corneum chymotryptic enzyme ;hSCCEGene Names: KLK7Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kallikrein-2 (KLK2) | CSB-EP012453HU | CusabioAlternative Name(s): Glandular kallikrein-1Gene Names: KLK2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kallikrein-10 (KLK10), partial | CSB-EP012447HU1 | CusabioAlternative Name(s): Normal epithelial cell-specific 1;Protease serine-like 1Gene Names: KLK10Research Areas: Cell CycleOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kallikrein-1 (KLK1) | CSB-EP012446HU | CusabioAlternative Name(s): Kidney/pancreas/salivary gland kallikrein;Tissue kallikreinGene Names: KLK1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kinesin light chain 3 (KLC3) | CSB-EP012381HU | CusabioAlternative Name(s): KLC2-like kinesin light chain 2Gene Names: KLC3Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kit ligand (KITLG), partial | CSB-EP012376HU | CusabioAlternative Name(s): Mast cell growth factor ;MGFStem cell factor ;SCFc-Kit ligandGene Names: KITLGResearch Areas: Developmental BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Kinesin-like protein KIF1C (Kif1c) | CSB-EP012320RA | CusabioAlternative Name(s): Kinesin-like protein KIF1DGene Names: Kif1cResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Kinesin-like protein KIF1A (Kif1a), partial | CSB-EP012318MO | CusabioAlternative Name(s): Axonal transporter of synaptic vesiclesGene Names: Kif1aResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human PCNA-associated factor (PCLAF) | CSB-EP012164HU | CusabioAlternative Name(s): Hepatitis C virus NS5A-transactivated protein 9 ;HCV NS5A-transactivated protein 9Overexpressed in anaplastic thyroid carcinoma 1 ;OEATC-1;PCNA-associated...

Recombinant Mouse Ketohexokinase (Khk) | CSB-EP012157MO | CusabioAlternative Name(s): Hepatic fructokinaseGene Names: KhkResearch Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Ketohexokinase (KHK) | CSB-EP012157HU | CusabioAlternative Name(s): Hepatic fructokinaseGene Names: KHKResearch Areas: Signal Transduction Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Kelch-like ECH-associated protein 1 (Keap1) | CSB-EP012147MO | CusabioAlternative Name(s): Cytosolic inhibitor of Nrf2 Short name: INrf2Gene Names: Keap1Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus (Mouse)AA...

Recombinant Human Vascular endothelial growth factor receptor 2 (KDR), partial | CSB-EP012145HU | CusabioAlternative Name(s): Fetal liver kinase 1 ;FLK-1Kinase insert domain receptor ;KDRProtein-tyrosine kinase receptor flk-1; CD309Gene Names:...

Recombinant Human Lysine-specific demethylase 5A (KDM5A) | CSB-EP012141HU | CusabioAlternative Name(s): Histone demethylase JARID1AJumonji/ARID domain-containing protein 1ARetinoblastoma-binding protein 2 ;RBBP-2Gene Names: KDM5AResearch Areas:...

Recombinant Mouse Kielin/chordin-like protein (Kcp), partial | CSB-EP012103MO | CusabioAlternative Name(s): Cysteine-rich BMP regulator 2 (Cysteine-rich motor neuron 2 protein) (CRIM-2) (Kielin/chordin-like protein 1) (KCP-1) (Crim2) (Kcp1)Gene Names:...

Recombinant Human Kielin/chordin-like protein (KCP), partial | CSB-EP012103HU | CusabioAlternative Name(s): Cysteine-rich BMP regulator 2 Cysteine-rich motor neuron 2 protein Kielin/chordin-like protein 1Gene Names: KCPResearch Areas: Signal...

Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10) , partial | CSB-EP012048HU1 | CusabioAlternative Name(s): ATP-dependent inwardly rectifying potassium channel Kir4.1Inward rectifier K(+) channel Kir1.2;Potassium channel,...

Recombinant Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1), partial | CSB-EP012047HU | CusabioAlternative Name(s): ATP-regulated potassium channel ROM-KInward rectifier K(+) channel Kir1.1;Potassium channel, inwardly rectifying...

Recombinant Rat Potassium voltage-gated channel subfamily E member 2 (Kcne2) | CSB-EP012027RA | CusabioAlternative Name(s): MinK-related peptide 1Minimum potassium ion channel-related peptide 1;Potassium channel subunit beta MiRP1Gene Names:...

Recombinant Human Potassium voltage-gated channel subfamily D member 1 protein (KCND1), partial | CSB-EP012022HU | CusabioAlternative Name(s): Voltage-gated potassium channel subunit Kv4.1Gene Names: KCND1Research Areas: NeuroscienceOrganism: Homo...

Recombinant Human Voltage-gated potassium channel subunit beta-2 (KCNAB2) | CSB-EP012014HU | CusabioAlternative Name(s): K(+) channel subunit beta-2Kv-beta-2 ;hKvbeta2Gene Names: KCNAB2Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA...

Recombinant Human Potassium voltage-gated channel subfamily A member 1 protein (KCNA1), partial | CSB-EP012005HU | CusabioAlternative Name(s): Voltage-gated K(+) channel HuKI1 Gene Names: KCNA1Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA...

Recombinant Chicken Anosmin-1 (ANOS1), partial | CSB-EP011978CH | CusabioAlternative Name(s): Kallmann syndrome protein homologGene Names: ANOS1Research Areas: OthersOrganism: Gallus gallus (Chicken)AA Sequence:...

Recombinant Brugia malayi Protein JTB (JTB), partial | CSB-EP011970BMV | CusabioAlternative Name(s): JTB; Protein JTBGene Names: JTBResearch Areas: Cell BiologyOrganism: Brugia malayi (Filarial nematode worm)AA Sequence:...

Recombinant Human JmjC domain-containing protein 7 (JMJD7) | CSB-EP011955HU | CusabioAlternative Name(s): Jumonji domain-containing protein 7Gene Names: JMJD7Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Junctional adhesion molecule B (JAM2), partial | CSB-EP011936HU | CusabioAlternative Name(s): Junctional adhesion molecule 2 ;JAM-2Vascular endothelial junction-associated molecule ;VE-JAM; CD322Gene Names: JAM2Research Areas:...

Recombinant Human Tyrosine-protein kinase JAK2 (JAK2), partial | CSB-EP011931HU | CusabioAlternative Name(s): Janus kinase 2 ;JAK-2Gene Names: JAK2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Tyrosine-protein kinase JAK1 (Jak1), partial | CSB-EP011930MO | CusabioAlternative Name(s): Janus kinase 1 Short name: JAK-1Gene Names: Jak1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Tyrosine-protein kinase JAK1 (Jak1), partial | CSB-EP011930HU | CusabioAlternative Name(s): Janus kinase 1 Short name: JAK-1Gene Names: JAK1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Inositol-trisphosphate 3-kinase B (ITPKB), partial | CSB-EP011910HU | CusabioAlternative Name(s): Inositol 1,4,5-trisphosphate 3-kinase B ;IP3 3-kinase B ;IP3K B ;InsP 3-kinase BGene Names: ITPKBResearch Areas: Signal...

Recombinant Bovine Inter-alpha-trypsin inhibitor heavy chain H2 (ITIH2) | CSB-EP011895BO | CusabioAlternative Name(s): /Gene Names: ITIH2Research Areas: Cell BiologyOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Human Integrin beta-like protein 1 (ITGBL1) | CSB-EP011893HU | CusabioAlternative Name(s): Osteoblast-specific cysteine-rich protein ?Ten integrin EGF-like repeat domain-containing protein?Gene Names: ITGBL1Research Areas: OthersOrganism:...

Recombinant Rabbit Integrin beta-8 (ITGB8), partial | CSB-EP011892RB | CusabioAlternative Name(s): ITGB8Integrin beta-8Gene Names: ITGB8Research Areas: Signal TransductionOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Human Integrin beta-7 (ITGB7), partial | CSB-EP011891HU1 | CusabioAlternative Name(s): Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is an adhesion molecule that mediates lymphocyte migration and homing to...

Recombinant Rat Integrin beta-1 (Itgb1) , partial | CSB-EP011880RA | CusabioAlternative Name(s): Beta oligodendroglia ;Beta OLFibronectin receptor subunit betaVLA-4 subunit beta; CD29Gene Names: Itgb1Research Areas: OthersOrganism: Rattus norvegicus...

Recombinant Mouse Integrin beta-1 (Itgb1), partial | CSB-EP011880MO | CusabioAlternative Name(s): Fibronectin receptor subunit beta VLA-4 subunit beta CD_antigen: CD29Gene Names: Itgb1Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Integrin alpha-L (Itgal), partial | CSB-EP011875MO | CusabioAlternative Name(s): CD11 antigen-like family member ALeukocyte adhesion glycoprotein LFA-1 alpha chain ;LFA-1ALeukocyte function-associated molecule 1 alpha chain;Lymphocyte...

Recombinant Human Integrin alpha-IIb (ITGA2B), partial | CSB-EP011865HU | CusabioAlternative Name(s): GPalpha IIb ;GPIIbPlatelet membrane glycoprotein IIb; CD41Gene Names: ITGA2BResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Integrin alpha-2 (ITGA2) , partial | CSB-EP011864HU | CusabioAlternative Name(s): CD49 antigen-like family member B Collagen receptor Platelet membrane glycoprotein Ia Short name: GPIa VLA-2 subunit alpha CD_antigen: CD49bGene Names:...

Recombinant Human Intestine-specific homeobox (ISX) | CSB-EP011854HU | CusabioAlternative Name(s): RAX-like homeoboxGene Names: ISXResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Isthmin-1 (ISM1) | CSB-EP011850HUa0 | CusabioAlternative Name(s): C20orf82, ISMGene Names: ISM1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Isthmin-1 (ISM1) | CSB-EP011850HU | CusabioAlternative Name(s): C20orf82, ISMGene Names: ISM1Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) | CSB-EP011843HUa0 | CusabioAlternative Name(s): Interferon-induced 15KDA proteinInterferon-induced 17KDA protein ;IP17Ubiquitin cross-reactive proteinGene Names: Isg15Research Areas:...

Recombinant Human Ubiquitin-like protein ISG15 (Isg15) | CSB-EP011843HU | CusabioAlternative Name(s): Interferon-induced 15KDA proteinInterferon-induced 17KDA protein ;IP17Ubiquitin cross-reactive proteinGene Names: Isg15Research Areas:...

Recombinant Bovine Ubiquitin-like protein ISG15 (ISG15) | CSB-EP011843BO | CusabioAlternative Name(s): Interferon-stimulated gene product 17 (Ubiquitin cross-reactive protein) (BoUCRP) (G1P2) (ISG17) (UCRP)Gene Names: ISG15Research Areas: Cell...

Recombinant Human Immunity-related GTPase family M protein (IRGM) | CSB-EP011827HU | CusabioAlternative Name(s): Immunity-related GTPase family M protein 1 Interferon-inducible protein 1 LPS-stimulated RAW 264.7 macrophage protein 47 homologGene Names:...

Recombinant Human Cis-aconitate decarboxylase (ACOD1) | CSB-EP011825HU | CusabioAlternative Name(s): Aconitate decarboxylase (Aconitate decarboxylase 1) (Cis-aconitic acid decarboxylase) (Immune-responsive gene 1 protein) (IRG1)Gene Names: ACOD1Research...

Recombinant Mouse Interferon regulatory factor 8 (Irf8) | CSB-EP011823MO | CusabioAlternative Name(s): Interferon consensus sequence-binding protein ;ICSBPGene Names: Irf8Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Interferon regulatory factor 7 (IRF7) | CSB-EP011822HU | CusabioAlternative Name(s): IRF-7Gene Names: IRF7Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Interferon regulatory factor 5 (Irf5) | CSB-EP011820MO | CusabioAlternative Name(s): Irf5Interferon regulatory factor 5; IRF-5Gene Names: Irf5Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Interferon regulatory factor 3 (Irf3) | CSB-EP011818MO | CusabioAlternative Name(s): Short name:IRF-3Gene Names: Irf3Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Interferon regulatory factor 1 (IRF1) (K29R) | CSB-EP011814HU(M1) | CusabioAlternative Name(s): IRF-1Gene Names: IRF1Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon regulatory factor 1 (IRF1) | CSB-EP011814HU(M) | CusabioAlternative Name(s): Gene Names: IRF1Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon regulatory factor 1 (IRF1) | CSB-EP011814HU | CusabioAlternative Name(s): IRF-1Gene Names: IRF1Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Interleukin-1 receptor-associated kinase 3 (Irak3) | CSB-EP011811MO | CusabioAlternative Name(s): IL-1 receptor-associated kinase M (IRAK-M) (IRAK-3)Gene Names: Irak3Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Inositol hexakisphosphate kinase 1 (IP6K1) | CSB-EP011770HU | CusabioAlternative Name(s): Inositol hexaphosphate kinase 1Gene Names: IP6K1Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Insulin receptor (INSR), partial | CSB-EP011753HU | CusabioAlternative Name(s): CD_antigen: CD220Gene Names: INSRResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rabbit Insulin (INS), partial | CSB-EP011742RB | CusabioAlternative Name(s): Insulin B chain;Insulin A chainGene Names: INSResearch Areas: Signal TransductionOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Horse Insulin (INS), partial | CSB-EP011742HO | CusabioAlternative Name(s): Gene Names: INSResearch Areas: Signal TransductionOrganism: Equus caballus (Horse)AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKASource: E.coliTag Info: N-terminal...

Recombinant Human Indolethylamine N-methyltransferase (INMT) | CSB-EP011723HU | CusabioAlternative Name(s): Aromatic alkylamine N-methyltransferase ;Amine N-methyltransferase ;Arylamine N-methyltransferaseThioether S-methyltransferase ;TEMTGene Names:...

Recombinant Human Inhibin beta A chain (INHBA) | CSB-EP011719HU | CusabioAlternative Name(s): Activin beta-A chain;Erythroid differentiation protein ;EDFGene Names: INHBAResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Bovine Inhibin alpha chain (INHA) | CSB-EP011718BO | CusabioAlternative Name(s): INHA; Inhibin alpha chainGene Names: INHAResearch Areas: Signal TransductionOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Human Integrin-linked kinase-associated serine/threonine phosphatase 2C (ILKAP) | CSB-EP011686HU | CusabioAlternative Name(s): DKFZp434J2031; FLJ10181; ILKAP; ILKAP_HUMAN; ILKAP2; ILKAP3; Integrin linked kinase associated phosphatase;...

Recombinant Human C-X-C chemokine receptor type 2 (CXCR2), partial | CSB-EP011673HU | CusabioAlternative Name(s): CDw128b GRO/MGSA receptor High affinity interleukin-8 receptor B Short name: IL-8R B IL-8 receptor type 2 CD_antigen: CD182Gene Names:...

Recombinant Sheep Interleukin-8 (IL8) | CSB-EP011671SH | CusabioAlternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Gene Names: IL8Research Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Human Interleukin-8 (CXCL8), partial | CSB-EP011671HU | CusabioAlternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin;Granulocyte chemotactic protein 1 ;GCP-1Monocyte-derived neutrophil chemotactic factor...

Recombinant Dog Interleukin-8 (IL8) | CSB-EP011671DO | CusabioAlternative Name(s): C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Gene Names: IL8Research Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant chicken Interleukin-8 (CXCL8), partial | CSB-EP011671CH1e1 | CusabioAlternative Name(s): 9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1Gene Names: CXCL8Research Areas: OthersOrganism: Gallus...

Recombinant Chicken Interleukin-8 (CXCL8), partial | CSB-EP011671CH1 | CusabioAlternative Name(s): 9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1 ;EMF-1Gene Names: CXCL8Research Areas: OthersOrganism: Gallus...

Recombinant Mouse Interleukin-7 receptor subunit alpha (Il7r), partial | CSB-EP011670MO | CusabioAlternative Name(s): Short name: IL-7 receptor subunit alpha Short name: IL-7R subunit alpha Short name: IL-7R-alpha Short name: IL-7RAGene Names:...

Recombinant Human Interleukin-7 receptor subunit alpha (IL7R), partial | CSB-EP011670HU1 | CusabioAlternative Name(s): CDw127Gene Names: IL7RResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Bovine Interleukin-7 (IL7) | CSB-EP011669BO | CusabioAlternative Name(s): IL-7Gene Names: IL7Research Areas: ImmunologyOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Sheep Interleukin-6 (IL6) | CSB-EP011664SH | CusabioAlternative Name(s): IL6; Interleukin-6; IL-6Gene Names: IL6Research Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Human Interleukin-6 (IL6) | CSB-EP011664HU | CusabioAlternative Name(s): B-cell stimulatory factor 2 ;BSF-2;CTL differentiation factor ;CDFHybridoma growth factorInterferon beta-2 ;IFN-beta-2Gene Names: IL6Research Areas: ImmunologyOrganism:...

Recombinant Sheep Interleukin-4 (IL4) | CSB-EP011659SH | CusabioAlternative Name(s): B-cell stimulatory factor 1Gene Names: IL4Research Areas: ImmunologyOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Human Interleukin-4 (IL4) | CSB-EP011659HUa0 | CusabioAlternative Name(s): B-cell stimulatory factor 1 ;BSF-1Binetrakin;Lymphocyte stimulatory factor 1;PitrakinraGene Names: IL4Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA...

Recombinant Human Interleukin-4 (IL-4) | CSB-EP011659HU | CusabioAlternative Name(s): B-cell stimulatory factor 1Gene Names: IL4Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Dog Interleukin-4 (IL4) | CSB-EP011659DO | CusabioAlternative Name(s): B-cell stimulatory factor 1 ;BSF-1Lymphocyte stimulatory factor 1Gene Names: L4Research Areas: OthersOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Pig Interleukin-33 (IL33), partial | CSB-EP011656PI | CusabioAlternative Name(s): /Gene Names: IL33Research Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...

Recombinant Human Interleukin-3 (IL3) | CSB-EP011652HUc7 | CusabioAlternative Name(s): Hematopoietic growth factor Mast cell growth factorGene Names: IL3Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...