Recombinant Mouse Kinesin-like protein KIF1A (Kif1a), partial | CSB-EP012318MO

Recombinant Mouse Kinesin-like protein KIF1A (Kif1a), partial | CSB-EP012318MO | Cusabio

Alternative Name(s): Axonal transporter of synaptic vesicles

Gene Names: Kif1a

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIIN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-361aa

Sequence Info: Partial

MW: 56.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Motor for anterograde axonal transport of synaptic vesicle precursors.

Reference: Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.Nitta R., Okada Y., Hirokawa N.Nat. Struct. Mol. Biol. 15:1067-1075(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Motor for anterograde axonal transport of synaptic vesicle precursors.

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton

Protein Families: TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family, Unc-104 subfamily

Tissue Specificity: Expressed almost exclusively in adult brain tissue (mainly in the cerebellum and cerebrum) within a single type of neuronal cell. Within the neuronal cell levels are concentrated around the axon, with smaller amounts in the perinuclear and synaptic regions.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P33173

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A