null

Recombinant chicken Interleukin-8 (CXCL8), partial | CSB-EP011671CH1e1

(No reviews yet) Write a Review
SKU:
CSB-EP011671CH1e1
Availability:
3 - 7 Working Days
  • Recombinant chicken Interleukin-8 (CXCL8), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€460.00 - €1,810.00
Frequently bought together:

Description

Recombinant chicken Interleukin-8 (CXCL8), partial | CSB-EP011671CH1e1 | Cusabio

Alternative Name(s): 9E3 C-X-C motif chemokine 8 CEF-4 Chemokine (C-X-C motif) ligand 8 Embryo fibroblast protein 1

Gene Names: CXCL8

Research Areas: Others

Organism: Gallus gallus (Chicken)

AA Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP

Source: E.coli

Tag Info: Tag-Free

Expression Region: 17-102aa

Sequence Info: Partial

MW: 9.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.

Reference: "Constitutive expression of a gene encoding a polypeptide homologous to biologically active human platelet protein in Rous sarcoma virus-transformed fibroblasts." Bedard P.-A., Alcorta D., Simmons D., Luk K.-C., Erikson R.L. Proc. Natl. Acad. Sci. U.S.A. 84:6715-6719(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be an autocrine factor that promotes the growth of fibroblasts and is involved in the neoplastic transformation of fibroblasts by v-Src. Chemotactic for peripheral blood mononuclear cells as well as for heterophils.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08317

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose