Recombinant Chicken Anosmin-1 (ANOS1), partial | CSB-EP011978CH

Recombinant Chicken Anosmin-1 (ANOS1), partial | CSB-EP011978CH | Cusabio

Alternative Name(s): Kallmann syndrome protein homolog

Gene Names: ANOS1

Research Areas: Others

Organism: Gallus gallus (Chicken)

AA Sequence: SPAGPGAATARRQDEAFSTARCTSRCLSLQITRISAFFKHFQNNGSLAWCQNHKQCSKCLEPCKESWDLKKNHCQSFCEPLFPKKNYECLTSCEFLKYILSVKQGDCPAPEKASGFAAACVESCEADSECSGVKKCCSNGCGHTCQVPKNLYKGVPLKPRKELKFIELQSGDLEVKWSSKFNISIEPVIYVVQRRWNQGIHPSEDDATNWQTVAQTTDERVQLSDIRASRWYQFRVAAVNVHGTRGFTAPSKHFRSSKDP

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-281aa

Sequence Info: Partial

MW: 33.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be an adhesion-like molecule with anti-protease activity.

Reference: "Expression of the KAL gene in multiple neuronal sites during chicken development."Legouis R., Lievre C.A., Leibovici M., Lapointe F., Petit C.Proc. Natl. Acad. Sci. U.S.A. 90:2461-2465(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be an adhesion-like molecule with anti-protease activity.

Involvement in disease:

Subcellular Location: Cell surface

Protein Families:

Tissue Specificity: Mainly expressed in neurons of the central nervous system during the second half of embryonic life. Expressed in mitral neurons of the olfactory bulbs, striatal neurons, Purkinje cells of the cerebellum, retinal neurons and neurons of the brainstem and spinal cord.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P33005

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A