Cusabio Human Recombinants
Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial | CSB-EP012467HU
- SKU:
- CSB-EP012467HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial | CSB-EP012467HU | Cusabio
Alternative Name(s): CD159 antigen-like family member CNK cell receptor CNKG2-C-activating NK receptor; CD159c
Gene Names: KLRC2
Research Areas: Immunology
Organism: Homo sapiens (Human)
AA Sequence: IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 94-231aa
Sequence Info: Extracellular Domain
MW: 31.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Reference: The structural basis for intramembrane assembly of an activating immunoreceptor complex.Call M.E., Wucherpfennig K.W., Chou J.J.Nat. Immunol. 11:1023-1029(2010)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type II membrane protein
Protein Families:
Tissue Specificity: Natural killer cells.
Paythway: Antigenprocessingandpresentation
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P26717
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM