Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial | CSB-EP012467HU

(No reviews yet) Write a Review
SKU:
CSB-EP012467HU
Availability:
13 - 23 Working Days
  • Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €1,277.00

Description

Recombinant Human NKG2-C type II integral membrane protein (KLRC2), partial | CSB-EP012467HU | Cusabio

Alternative Name(s): CD159 antigen-like family member CNK cell receptor CNKG2-C-activating NK receptor; CD159c

Gene Names: KLRC2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: IPFLEQNNSSPNTRTQKARHCGHCPEEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLASILPSSWIGVFRNSSHHPWVTINGLAFKHKIKDSDNAELNCAVLQVNRLKSAQCGSSMIYHCKHKL

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 94-231aa

Sequence Info: Extracellular Domain

MW: 31.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

Reference: The structural basis for intramembrane assembly of an activating immunoreceptor complex.Call M.E., Wucherpfennig K.W., Chou J.J.Nat. Immunol. 11:1023-1029(2010)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.

Involvement in disease:

Subcellular Location: Membrane, Single-pass type II membrane protein

Protein Families:

Tissue Specificity: Natural killer cells.

Paythway: Antigenprocessingandpresentation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P26717

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose