E.coli Recombinant

Recombinant Human Interleukin-3 (IL3) | CSB-EP011652HU | CusabioAlternative Name(s): Hematopoietic growth factorMast cell growth factor ;MCGFMultipotential colony-stimulating factorP-cell-stimulating factorGene Names: IL3Research Areas:...

Recombinant Mouse Interleukin-2 receptor subunit beta (Il2rb), partial | CSB-EP011650MO1 | CusabioAlternative Name(s): High affinity IL-2 receptor subunit betap70-75; CD122Gene Names: l2rbResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rabbit Interleukin-2 (IL2) | CSB-EP011629RB | CusabioAlternative Name(s): T-cell growth factor Short name:TCGFGene Names: IL2Research Areas: OthersOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Macaca mulatta Interleukin-2 (IL2) | CSB-EP011629MOW | CusabioAlternative Name(s): T-cell growth factorGene Names: IL2Research Areas: ImmunologyOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Human Interleukin-2 (IL2) | CSB-EP011629HUc7 | CusabioAlternative Name(s): T-cell growth factorGene Names: IL2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-2 (IL2) | CSB-EP011629HU | CusabioAlternative Name(s): T-cell growth factor ;TCGFINN: AldesleukinGene Names: IL2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Sheep Interleukin-1 beta (IL1B) | CSB-EP011614SH | CusabioAlternative Name(s): IL1BInterleukin-1 beta; IL-1 betaGene Names: IL1BResearch Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Human Interleukin-1 beta (IL1B) | CSB-EP011614HUe0 | CusabioAlternative Name(s): CatabolinGene Names: IL1BResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-1 beta (IL1B) | CSB-EP011614HU | CusabioAlternative Name(s): CatabolinGene Names: IL1BResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha (IL1A) | CSB-EP011613MOW | CusabioAlternative Name(s): Hematopoietin-1Gene Names: IL1AResearch Areas: OthersOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Human Interleukin-1 alpha (IL1A) | CSB-EP011613HUe0 | CusabioAlternative Name(s): Hematopoietin-1Gene Names: IL1AResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-1 alpha (IL1A), Biotinylated | CSB-EP011613HU-B | CusabioAlternative Name(s): Hematopoietin-1Gene Names: IL1AResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-1 alpha (IL1A) | CSB-EP011613HU | CusabioAlternative Name(s): Hematopoietin-1Gene Names: IL1AResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-18-binding protein (IL18BP), partial | CSB-EP011609HU1 | CusabioAlternative Name(s): Tadekinig-alfaGene Names: IL18BPResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Interleukin-18 (Il18) | CSB-EP011608MOe1 | CusabioAlternative Name(s): Gene Names: Il18Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Interleukin-18 (Il18) | CSB-EP011608MO | CusabioAlternative Name(s): Interferon gamma-inducing factor (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma) (IL-18) (Igif)Gene Names: Il18Research Areas: ImmunologyOrganism: Mus...

Recombinant Rabbit IL-17A protein (Il17a) | CSB-EP011597RB | CusabioAlternative Name(s): /Gene Names: IL17AResearch Areas: OthersOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Macaca mulatta Uncharacterized protein (IL17A) | CSB-EP011597MOV | CusabioAlternative Name(s): /Gene Names: IL17AResearch Areas: OthersOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Human Interleukin-15 (IL15) | CSB-EP011593HU | CusabioAlternative Name(s): IL 15; IL-15; IL15; IL15_HUMAN; Interleukin 15; Interleukin-15; Interleukin15; MGC9721Gene Names: IL15Research Areas: MetabolismOrganism: Homo sapiens (Human)AA...

Recombinant Sheep Interleukin-12 subunit beta (IL12B) | CSB-EP011587SH | CusabioAlternative Name(s): Cytotoxic lymphocyte maturation factor 40KDA subunit ;CLMF p40IL-12 subunit p40Gene Names: IL12BResearch Areas: OthersOrganism: Ovis aries (Sheep)AA...

Recombinant Human Interleukin-12 subunit beta (IL12B) | CSB-EP011587HU | CusabioAlternative Name(s): Cytotoxic lymphocyte maturation factor 40KDA subunit ;CLMF p40IL-12 subunit p40NK cell stimulatory factor chain 2 ;NKSF2Gene Names: IL12BResearch Areas:...

Recombinant Mouse Interleukin-11 (Il11), Biotinylated | CSB-EP011583MO-B | CusabioAlternative Name(s): IL-11Gene Names: Il11Research Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Macaca mulatta Interleukin-10 (IL10) | CSB-EP011580MOW | CusabioAlternative Name(s): Cytokine synthesis inhibitory factorGene Names: IL10Research Areas: ImmunologyOrganism: Macaca mulatta (Rhesus macaque)AA Sequence:...

Recombinant Human Interleukin-10 (IL10) | CSB-EP011580HU | CusabioAlternative Name(s): Cytokine synthesis inhibitory factor ;CSIFGene Names: IL10Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Zinc finger protein Helios (Ikzf2) | CSB-EP011576MO | CusabioAlternative Name(s): Ikaros family zinc finger protein 2 (Helios) (Zfpn1a2) (Znfn1a2)Gene Names: Ikzf2Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Human Inhibitor of nuclear factor kappa-B kinase subunit beta (IKBKB) | CSB-EP011572HU | CusabioAlternative Name(s): I-kappa-B kinase 2 (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB) (I-kappa-B-kinase beta) (IKK-B)...

Recombinant Mouse Immunoglobulin J chain (Jchain) | CSB-EP011337MO | CusabioAlternative Name(s): IgjGene Names: JchainResearch Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Immunoglobulin J chain (JCHAIN) | CSB-EP011337HU | CusabioAlternative Name(s): Joining chain of multimeric IgA and IgMGene Names: JCHAINResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Ig gamma-1 chain C region (IGHG1) | CSB-EP011156HU(A4) | CusabioAlternative Name(s): Ig gamma-1 chain C region Ig gamma-1 chain C region EU2 Ig gamma-1 chain C region KOL1 Ig gamma-1 chain C region NIEGene Names: IGHG1Research Areas:...

Recombinant Human Ig gamma-1 chain C region (IGHG1) | CSB-EP011156HU | CusabioAlternative Name(s): IGHG1; Immunoglobulin heavy constant gamma 1; Ig gamma-1 chain C region; Ig gamma-1 chain C region EU; Ig gamma-1 chain C region KOL; Ig gamma-1 chain C...

Recombinant Human Insulin-like growth factor-binding protein 5 (IGFBP5) | CSB-EP011099HU | CusabioAlternative Name(s): IBP-5;IGF-binding protein 5;IGFBP-5Gene Names: IGFBP5Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Insulin-like growth factor-binding protein 1 (Igfbp1) | CSB-EP011095RAe1 | CusabioAlternative Name(s): Igfbp1; Igfbp-1; Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1Gene Names: Igfbp1Research Areas:...

Recombinant Rat Insulin-like growth factor-binding protein 1 (Igfbp1) | CSB-EP011095RAa2 | CusabioAlternative Name(s): Igfbp1; Igfbp-1; Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1Gene Names: Igfbp1Research Areas:...

Recombinant Rat Insulin-like growth factor-binding protein 1 (Igfbp1) | CSB-EP011095RA | CusabioAlternative Name(s): Igfbp1; Igfbp-1; Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1Gene Names: Igfbp1Research Areas:...

Recombinant Mouse Insulin-like growth factor-binding protein 1 (Igfbp1) | CSB-EP011095MO | CusabioAlternative Name(s): Igfbp1; Igfbp-1; Insulin-like growth factor-binding protein 1; IBP-1; IGF-binding protein 1; IGFBP-1Gene Names: Igfbp1Research Areas:...

Recombinant Human Cation-independent mannose-6-phosphate receptor (IGF2R), partial | CSB-EP011093HU | CusabioAlternative Name(s): 46KDA mannose 6-phosphate receptor ;MPR 46Gene Names: IGF2RResearch Areas: TransportOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Insulin-like growth factor II (Igf2) | CSB-EP011088MO | CusabioAlternative Name(s): IGF-II (Multiplication-stimulating polypeptide) (Igf-2)Gene Names: Igf2Research Areas: Signal TransductionOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial | CSB-EP011087HUa0 | CusabioAlternative Name(s): Insulin-like growth factor I receptor ;IGF-I receptor; CD221Gene Names: IGF1RResearch Areas: Signal TransductionOrganism: Homo...

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial | CSB-EP011087HU | CusabioAlternative Name(s): Insulin-like growth factor I receptor ;IGF-I receptor; CD221Gene Names: IGF1RResearch Areas: Signal TransductionOrganism: Homo sapiens...

Recombinant Bovine Interferon omega-1 (IFNW1) | CSB-EP011061BO | CusabioAlternative Name(s): IFN-omega-c1 Interferon alpha-II-1Gene Names: IFNW1Research Areas: ImmunologyOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Sheep Interferon gamma (IFNG) | CSB-EP011050SH | CusabioAlternative Name(s): IFNG; Interferon gamma; IFN-gammaGene Names: IFNGResearch Areas: OthersOrganism: Ovis aries (Sheep)AA Sequence:...

Recombinant Rat Interferon gamma (Ifng) | CSB-EP011050RA | CusabioAlternative Name(s): IfngInterferon gamma; IFN-gammaGene Names: IfngResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Marmota monax Interferon gamma (IFNG) | CSB-EP011050MQG | CusabioAlternative Name(s): Short name:IFN-gammaGene Names: IFNGResearch Areas: OthersOrganism: Marmota monax (Woodchuck)AA Sequence:...

Recombinant Mouse Interferon gamma (Ifng), partial | CSB-EP011050MO1 | CusabioAlternative Name(s): Ifng; Interferon gamma; IFN-gammaGene Names: IfngResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Interferon gamma (IFNG) | CSB-EP011050HU | CusabioAlternative Name(s): Immune interferonGene Names: IFNGResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Goat Interferon gamma (IFNG) | CSB-EP011050GO | CusabioAlternative Name(s): /Gene Names: IFNGResearch Areas: ImmunologyOrganism: Capra hircus (Goat)AA Sequence:...

Recombinant Chicken Interferon gamma (IFNG) | CSB-EP011050CH | CusabioAlternative Name(s): IFNG; Interferon gamma; IFN-gammaGene Names: IFNGResearch Areas: OthersOrganism: Gallus gallus (Chicken)AA Sequence:...

Recombinant Human Interferon beta protein (IFNB1) | CSB-EP011048HU | CusabioAlternative Name(s): Fibroblast interferonGene Names: IFNB1Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha/beta receptor 2 (IFNAR2), partial | CSB-EP011047HU | CusabioAlternative Name(s): Interferon alpha binding protein;Type I interferon receptor 2Gene Names: IFNAR2Research Areas: Epigenetics and Nuclear SignalingOrganism:...

Recombinant Mouse Interferon alpha-7 (Ifna7) | CSB-EP011043MOe1 | CusabioAlternative Name(s): IFN-alpha-7 (Ifa7)Gene Names: Ifna7Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Interferon alpha-6 (IFNA6) | CSB-EP011042HU | CusabioAlternative Name(s): Interferon alpha-54 Interferon alpha-K Short name: LeIF KGene Names: IFNA6Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-4 (IFNA4), partial | CSB-EP011040HU | CusabioAlternative Name(s): Interferon alpha-4BInterferon alpha-76Interferon alpha-M1Gene Names: IFNA4Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-21 (IFNA21) | CSB-EP011039HU | CusabioAlternative Name(s): Interferon alpha-F ;LeIF FGene Names: IFNA21Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-16 (IFNA16) | CSB-EP011036HU | CusabioAlternative Name(s): IFN-alpha-16;Interferon alpha-WAGene Names: IFNA16Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-14 (IFNA14) | CSB-EP011035HUe0 | CusabioAlternative Name(s): Interferon alpha-H ;LeIF HInterferon lambda-2-HGene Names: IFNA14Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-14 (IFNA14) | CSB-EP011035HU | CusabioAlternative Name(s): Interferon alpha-HGene Names: IFNA14Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-10 (IFNA10) | CSB-EP011033HU | CusabioAlternative Name(s): Interferon alpha-6LInterferon alpha-C ;LeIF CGene Names: IFNA10Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon-induced transmembrane protein 1 (IFITM1) , partial | CSB-EP011024HU1 | CusabioAlternative Name(s): Dispanin subfamily A member 2a ;DSPA2aInterferon-induced protein 17Interferon-inducible protein 9-27Leu-13 antigen; CD225Gene...

Recombinant Human Interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) | CSB-EP011022HU | CusabioAlternative Name(s): CIG49ISG-60Interferon-induced 60KDA protein ;IFI-60KInterferon-induced protein with tetratricopeptide repeats 4...

Recombinant Human Interferon alpha-inducible protein 6 (IFI6) | CSB-EP011016HU | CusabioAlternative Name(s): Interferon-induced protein 6-16Gene Names: IFI6Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Alpha-L-iduronidase (IDUA) | CSB-EP011000HU | CusabioAlternative Name(s): IDUA; Alpha-L-iduronidase; EC 3.2.1.76Gene Names: IDUAResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Indoleamine 2, 3-dioxygenase 2 (IDO2), partial | CSB-EP010997HU | CusabioAlternative Name(s): Indoleamine 2,3-dioxygenase-like protein 1Indoleamine-pyrrole 2,3-dioxygenase-like protein 1Gene Names: IDO2Research Areas:...

Recombinant Human Indoleamine 2, 3-dioxygenase 1 (IDO1) | CSB-EP010996HU | CusabioAlternative Name(s): Indoleamine-pyrrole 2,3-dioxygenaseGene Names: IDO1Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial (IDH3G) | CSB-EP010993HU | CusabioAlternative Name(s): Isocitric dehydrogenase subunit gammaNAD(+)-specific ICDH subunit gammaGene Names: IDH3GResearch Areas: Signal...

Recombinant Human Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial (IDH3B) | CSB-EP010992HU | CusabioAlternative Name(s): Isocitric dehydrogenase subunit betaNAD(+)-specific ICDH subunit betaGene Names: IDH3BResearch Areas: MetabolismOrganism:...

Recombinant Mouse Isocitrate dehydrogenase [NADP] Cytoplasmic domain (Idh1), partial | CSB-EP010989MO | CusabioAlternative Name(s): Cytosolic NADP-isocitrate dehydrogenaseIDPNADP(+)-specific ICDHOxalosuccinate decarboxylaseGene Names: Idh1Research Areas:...

Recombinant Human Isocitrate dehydrogenase [NADP] cytoplasmic (IDH1) | CSB-EP010989HUc7 | CusabioAlternative Name(s): Cytosolic NADP-isocitrate dehydrogenase (IDP) (NADP(+)-specific ICDH) (Oxalosuccinate decarboxylase) (IDH) (PICD)Gene Names:...

Recombinant Human DNA-binding protein inhibitor ID-2 (ID2) | CSB-EP010967HU | CusabioAlternative Name(s): Class B basic helix-loop-helix protein 26 ;bHLHb26Inhibitor of DNA binding 2Inhibitor of differentiation 2Gene Names: ID2Research Areas: Epigenetics...

Recombinant Human DNA-binding protein inhibitor ID-1 (ID1) | CSB-EP010966HU | CusabioAlternative Name(s): Class B basic helix-loop-helix protein 24 ;bHLHb24Inhibitor of DNA binding 1Inhibitor of differentiation 1Gene Names: ID1Research Areas:...

Recombinant Human Intercellular adhesion molecule 1 (ICAM1), partial | CSB-EP010949HU | CusabioAlternative Name(s): Major group rhinovirus receptor; CD54Gene Names: ICAM1Research Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Islet cell autoantigen 1 (ICA1) | CSB-EP010947HU(F1) | CusabioAlternative Name(s): 69KDA islet cell autoantigen Short name: ICA69 Islet cell autoantigen p69 Short name: ICAp69 Short name: p69Gene Names: ICA1Research Areas:...

Recombinant Human Islet cell autoantigen 1 (ICA1), partial | CSB-EP010947HU | CusabioAlternative Name(s): 69KDA islet cell autoantigen ;ICA69Islet cell autoantigen p69 ;ICAp69 ;p69Gene Names: ICA1Research Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Bone sialoprotein 2 (IBSP), partial | CSB-EP010945HU(A4) | CusabioAlternative Name(s): Bone sialoprotein IIGene Names: IBSPResearch Areas: OthersOrganism: Homo sapiens (Human) AA Sequence:...

Recombinant Human Islet amyloid polypeptide (IAPP), partial | CSB-EP010931HU | CusabioAlternative Name(s): PYY-IGene Names: IAPP Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYSource: E...

Recombinant Human Checkpoint protein HUS1 (HUS1), partial | CSB-EP010909HU | CusabioAlternative Name(s): Checkpoint protein HUS1; hHUS1; HUS1 (S. pombe) checkpoint homolog; Hus1; HUS1 checkpoint homolog (S. pombe); HUS1 Checkpoint Protein; HUS1 protein;...

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial | CSB-EP010883HU2 | CusabioAlternative Name(s): 5-hydroxytryptamine receptor 1D(5-HT-1D)(5-HT1D)(Serotonin 1D alpha receptor)(5-HT-1D-alpha)(Serotonin receptor 1D)Gene Names:...

Recombinant Mouse Endoplasmic reticulum chaperone BiP (Hspa5) | CSB-EP010827MO | CusabioAlternative Name(s): 78 kDa glucose-regulated protein (GRP-78) (Binding-immunoglobulin protein) (BiP) (Heat shock protein 70 family protein 5) (HSP70 family protein...

Recombinant Human 78KDA glucose-regulated protein (HSPA5), partial | CSB-EP010827HU1 | CusabioAlternative Name(s): Endoplasmic reticulum lumenal Ca(2+)-binding protein grp78Heat shock 70KDA protein 5Immunoglobulin heavy chain-binding protein ;BiPGene...

Recombinant Mouse Heat shock 70KDA protein 1B (Hspa1b) | CSB-EP010822MO | CusabioAlternative Name(s): Heat shock 70KDA protein 1 Short name: HSP70.1Gene Names: Hspa1bResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Endoplasmin (HSP90B1), partial | CSB-EP010814HU1 | CusabioAlternative Name(s): 94KDA glucose-regulated protein ;GRP-94Heat shock protein 90KDA beta member 1Tumor rejection antigen 1gp96 homologGene Names: HSP90B1Research Areas:...

Recombinant Human Heat shock protein HSP 90-beta (HSP90AB1) | CSB-EP010808HU | CusabioAlternative Name(s): Heat shock 84KDAGene Names: HSP90AB1Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Heat shock protein HSP 90-alpha (HSP90AA1), partial | CSB-EP010802HU4 | CusabioAlternative Name(s): Heat shock 86KDA ;HSP 86 ;HSP86Lipopolysaccharide-associated protein 2 ;LAP-2 ;LPS-associated protein 2Renal carcinoma antigen...

Recombinant Human Heat shock protein HSP 90-alpha (HSP90AA1), partial | CSB-EP010802HU3 | CusabioAlternative Name(s): Heat shock 86KDA ;HSP 86 ;HSP86Lipopolysaccharide-associated protein 2 ;LAP-2 ;LPS-associated protein 2Renal carcinoma antigen...

Recombinant Human Heat shock protein HSP 90-alpha (HSP90AA1), partial | CSB-EP010802HU2 | CusabioAlternative Name(s): Heat shock 86KDA ;HSP 86 ;HSP86Lipopolysaccharide-associated protein 2 ;LAP-2 ;LPS-associated protein 2Renal carcinoma antigen...

Recombinant Human Heat shock protein HSP 90-alpha (HSP90AA1), partial | CSB-EP010802HU1 | CusabioAlternative Name(s): Heat shock 86KDA ;HSP 86 ;HSP86Lipopolysaccharide-associated protein 2 ;LAP-2 ;LPS-associated protein 2Renal carcinoma antigen...

Recombinant Human 3 beta-hydroxysteroid dehydrogenase/Delta 5--4-isomerase type 1 (HSD3B1), partial | CSB-EP010781HU1 | CusabioAlternative Name(s): 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type IGene Names: HSD3B1Research Areas:...

Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 1 (HSD11B1), partial | CSB-EP010763HU | CusabioAlternative Name(s): 11-beta-hydroxysteroid dehydrogenase 1 ;11-DH ;11-beta-HSD1Short chain dehydrogenase/reductase family 26C member 1Gene...

Recombinant Human Ribonuclease UK114 (HRSP12) | CSB-EP010744HU | CusabioAlternative Name(s): 14.5KDA translational inhibitor protein ;p14.5Heat-responsive protein 12UK114 antigen homologGene Names: HRSP12Research Areas: Epigenetics and Nuclear...

Recombinant Human Histamine H1 receptor (HRH1), partial | CSB-EP010737HU | CusabioAlternative Name(s): Short name:H1R Short name:HH1RGene Names: HRH1Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Hemopexin (Hpx) | CSB-EP010723RA | CusabioAlternative Name(s): Hpx; HemopexinGene Names: HpxResearch Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Heparanase (Hpse), partial | CSB-EP010716RA | CusabioAlternative Name(s): Endo-glucoronidase (Hep)Gene Names: HpseResearch Areas: CancerOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Human Hypoxanthine-guanine phosphoribosyltransferase (HPRT1) | CSB-EP010706HU | CusabioAlternative Name(s): /Gene Names: HPRT1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human 4-hydroxyphenylpyruvate dioxygenase (HPD) | CSB-EP010698HU | CusabioAlternative Name(s): 4-hydroxyphenylpyruvic acid oxidase ;4HPPD ;HPD ;HPPDaseGene Names: HPDResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Haptoglobin (HP) | CSB-EP010691HUe1 | CusabioAlternative Name(s): ZonulinGene Names: HPResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Haptoglobin (HP) | CSB-EP010691HU | CusabioAlternative Name(s): Alternative name(s): ZonulinGene Names: HPResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Heterogeneous nuclear ribonucleoprotein M (HNRNPM) | CSB-EP010613HUa2 | CusabioAlternative Name(s): CEA receptor; CEAR; Heterogeneous nuclear ribonucleoprotein M; Heterogenous nuclear ribonucleoprotein M4; hnRNA binding protein M4;...

Recombinant Human Heterogeneous nuclear ribonucleoprotein M (HNRNPM) | CSB-EP010613HU | CusabioAlternative Name(s): hnRNP M (HNRPM) (NAGR1)Gene Names: HNRNPMResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Heterogeneous nuclear ribonucleoprotein L (HNRNPL) | CSB-EP010612HU(F1) | CusabioAlternative Name(s): D830027H13Rik; FLJ35509; Heterogeneous nuclear ribonucleoprotein L; hnRNP L; hnRNP-L; Hnrnpl; hnRPL; HNRPL_HUMAN; P/OKcl.14Gene Names:...

Recombinant Human Heterogeneous nuclear ribonucleoprotein L (HNRNPL), partial | CSB-EP010612HU | CusabioAlternative Name(s): D830027H13Rik; FLJ35509; Heterogeneous nuclear ribonucleoprotein L; hnRNP L; hnRNP-L; Hnrnpl; hnRPL; HNRPL_HUMAN; P/OKcl.14Gene...

Recombinant Human Heterogeneous nuclear ribonucleoprotein K (HNRNPK), partial | CSB-EP010611HU | CusabioAlternative Name(s): Transformation up-regulated nuclear protein ;TUNPGene Names: HNRNPKResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA...