Cusabio Ovis aries Recombinants
Recombinant Sheep Interleukin-6 (IL6) | CSB-EP011664SH
- SKU:
- CSB-EP011664SH
- UPC:
- MPN:
- Availability:
- 3 - 7 Working Days
Description
Recombinant Sheep Interleukin-6 (IL6) | CSB-EP011664SH | Cusabio
Alternative Name(s): IL6; Interleukin-6; IL-6
Gene Names: IL6
Research Areas: Others
Organism: Ovis aries (Sheep)
AA Sequence: GPLGEDFKNDTTPSRLLLTTPEKTEALIKHIVDKISAIRKEICEKNDECENSKETLAENKLKLPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEFEGNQETVMELQSSIRTLIQILKEKIAGLITTPATHTDMLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 30-208aa
Sequence Info: Full Length of Mature Protein
MW: 47.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hatopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation .
Reference: Molecular cloning and characterization of a ruminant interleukin-6 cDNA.Andrews A.E., Barcham G.J., Ashman K., Meeusen E.N.T., Brandon M.R., Nash A.D.Immunol. Cell Biol. 71:341-348(1993)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. Acts on B-cells, T-cells, hepatocytes, hematopoietic progenitor cells and cells of the CNS. Required for the generation of T(H)17 cells. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation (By similarity).
Involvement in disease:
Subcellular Location: Secreted
Protein Families: IL-6 superfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P29455
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A
Related Products

Recombinant Human Interleukin-6 (IL6) | CSB-EP011664HU
Cusabio Human Recombinants

Recombinant Sheep Interleukin-6 (IL6) | CSB-YP011664SH
Cusabio Ovis aries Recombinants

Recombinant Rabbit Interleukin-6 (IL6) | CSB-YP863071RB
Cusabio Oryctolagus cuniculus Recombinants

Recombinant Human Interleukin-6 protein (IL6) (Active) | CSB-AP001741HU
Cusabio Active Proteins

Recombinant Rhesus Macaque Interleukin-6 protein (IL6) (Active) | CSB-AP003101MOW
Cusabio Active Proteins
Customers Also Viewed

VSV-G-Tag Monoclonal Antibody | CSB-MA000161
Cusabio Tag & Control

Rabbit anti-Sheep IgG Antibody | CSB-PA00110E1Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;FITC conjugated | CSB-PA00410G0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody;Biotin conjugated | CSB-PA00410H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Chicken Yolk Immunoglobulin Antibody | CSB-PA00410E0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;Biotin conjugated | CSB-PA00570H0Rb
Cusabio Secondary Antibodies

Rabbit anti-Goat IgG Fc Antibody;HRP conjugated | CSB-PA00570F0Rb
Cusabio Secondary Antibodies

Goat Anti-Rabbit IgG(H+L) Antibody; HRP conjugated | CSB-PA564648
Cusabio Secondary Antibodies

MET Antibody | CSB-RA634199A0HU
Cusabio Recombinant Antibodies

HSF1 Antibody | CSB-RA279005A0HU
Cusabio Recombinant Antibodies

ABAT Antibody | CSB-RA242969A0HU
Cusabio Recombinant Antibodies

AKR1C3 Antibody | CSB-RA825204A0HU
Cusabio Recombinant Antibodies

RHOA Antibody | CSB-RA546523A0HU
Cusabio Recombinant Antibodies

FGFR2 Antibody | CSB-RA154582A0HU
Cusabio Recombinant Antibodies

ESR1 Antibody | CSB-RA942338A0HU
Cusabio Recombinant Antibodies

RPTOR Antibody | CSB-RA581950A0HU
Cusabio Recombinant Antibodies

CEACAM1 Antibody | CSB-RA147192A0HU
Cusabio Recombinant Antibodies

GSK3B Antibody | CSB-RA216259A0HU
Cusabio Recombinant Antibodies

SIRT1 Antibody | CSB-RA556800A0HU
Cusabio Recombinant Antibodies

NONO Antibody | CSB-RA273277A0HU
Cusabio Recombinant Antibodies

RPS6KB1 Antibody | CSB-RA299200A0HU
Cusabio Recombinant Antibodies

MAPK14 Antibody | CSB-RA582884A0HU
Cusabio Recombinant Antibodies

CDK2 Antibody | CSB-RA961467A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA241798A0HU
Cusabio Recombinant Antibodies

CASP3 Antibody | CSB-RA286668A0HU
Cusabio Recombinant Antibodies

CD47 Antibody | CSB-RA802124A0HU
Cusabio Recombinant Antibodies

BCHE Antibody | CSB-RA252650A0HU
Cusabio Recombinant Antibodies

CD80 Antibody | CSB-RA246383A0HU
Cusabio Recombinant Antibodies

ACLY Antibody | CSB-RA712206A0HU
Cusabio Recombinant Antibodies

ATF4 Antibody | CSB-RA002272A0HU
Cusabio Recombinant Antibodies

ARNT Antibody | CSB-RA002121A0HU
Cusabio Recombinant Antibodies

Phospho-SNCA (S129) Antibody | CSB-RA021912A129phHU
Cusabio Recombinant Antibodies

Acetyl-Histone H2B type 1-B(K20)Antibody | CSB-RA010402A20acHU
Cusabio Recombinant Antibodies

Acetyl-Histone H3.1(K56)Antibody | CSB-RA010418A56acHU
Cusabio Recombinant Antibodies

Histone H3.3 Antibody | CSB-RA010109A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H1.4 (T17) Antibody | CSB-RA010380A17phHU
Cusabio Recombinant Antibodies

CD45 Antibody | CSB-RA019049A0HU
Cusabio Recombinant Antibodies

Phospho-Histone H3.3 (T3) Antibody | CSB-RA010109A03phHU
Cusabio Recombinant Antibodies

VPS26A Antibody, Biotin conjugated | CSB-PA025898LD01HU
Cusabio Polyclonal Antibodies

SUMF2 Antibody, Biotin conjugated | CSB-PA839844LD01HU
Cusabio Polyclonal Antibodies

SRC Antibody, FITC conjugated | CSB-PA022650LC11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB11HU
Cusabio Polyclonal Antibodies

SRC Antibody | CSB-PA022650LA11HU
Cusabio Polyclonal Antibodies

SRC Antibody, HRP conjugated | CSB-PA022650LB01HU
Cusabio Polyclonal Antibodies

PIBF1 Antibody, HRP conjugated | CSB-PA845171LB01HU
Cusabio Polyclonal Antibodies

PCDHA10 Antibody, HRP conjugated | CSB-PA897505LB11HU
Cusabio Polyclonal Antibodies

PCDHA10 Antibody, HRP conjugated | CSB-PA897505LB01HU
Cusabio Polyclonal Antibodies

DLG4 Antibody, Biotin conjugated | CSB-PA006938LD01HU
Cusabio Polyclonal Antibodies

DLG4 Antibody,FITC conjugated | CSB-PA006938LC01HU
Cusabio Polyclonal Antibodies

DLG4 Antibody, HRP conjugated | CSB-PA006938LB01HU
Cusabio Polyclonal Antibodies