Recombinant Human Kallikrein-10 (KLK10), partial | CSB-EP012447HU1

Recombinant Human Kallikrein-10 (KLK10), partial | CSB-EP012447HU1 | Cusabio

Alternative Name(s): Normal epithelial cell-specific 1;Protease serine-like 1

Gene Names: KLK10

Research Areas: Cell Cycle

Organism: Homo sapiens (Human)

AA Sequence: AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 31-274aa

Sequence Info: Partial

MW: 30.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Has a tumor-suppressor role for NES1 in breast and prostate cancer.

Reference: The role for NES1 serine protease as a novel tumor suppressor.Goyal J., Smith K.M., Cowan J.M., Wazer D.E., Lee S.W., Band V.Cancer Res. 58:4782-4786(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has a tumor-suppressor role for NES1 in breast and prostate cancer.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S1 family, Kallikrein subfamily

Tissue Specificity: Expressed in breast, ovary and prostate.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O43240

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM