null

Recombinant Rat Plasma kallikrein (Klkb1), partial | CSB-YP012461RA

(No reviews yet) Write a Review
SKU:
CSB-YP012461RA
Availability:
3 - 7 Working Days
  • Recombinant Rat Plasma kallikrein (Klkb1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,135.00
Frequently bought together:

Description

Recombinant Rat Plasma kallikrein (Klkb1), partial | CSB-YP012461RA | Cusabio

Alternative Name(s): Fletcher factorKininogenin;Plasma prekallikrein

Gene Names: Klkb1

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: IVGGTNSSLGEWPWQVSLQVKLVSQNHMCGGSIIGRQWILTAAHCFDGIPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKERGETQNILQKATIPLVPNEECQKKYRDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGVYTKVAEYIDWILEKIQSSKERALETSPA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 391-638aa

Sequence Info: Partial

MW: 29.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin syst by converting prorenin into renin.

Reference: Gene structure and chromosomal localization of plasma kallikrein.Beaubien G., Rosinski-Chupin I., Mattei M.-G., Mbikay M., Chretien M., Seidah N.G.Biochemistry 30:1628-1635(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Peptidase S1 family, Plasma kallikrein subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P14272

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose