Cusabio Human Recombinants
Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40) | CSB-EP024050HU
- SKU:
- CSB-EP024050HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40) | CSB-EP024050HU | Cusabio
Alternative Name(s): Protein Haymaker Translocase of outer membrane 40KDA subunit homolog p38.5
Gene Names: TOMM40
Research Areas: Tags & Cell Markers
Organism: Homo sapiens (Human)
AA Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-361aa
Sequence Info: Full Length
MW: 64.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication
Reference: "Sequencing of 42kb of the APO E-C2 gene cluster reveals a new gene: PEREC1." Freitas E.M., Zhang W.J., Lalonde J.P., Tay G.K., Gaudieri S., Ashworth L.K., Van Bockxmeer F.M., Dawkins R.L. DNA Seq. 9:89-100(1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Channel-forming protein essential for import of protein precursors into mitochondria.
Involvement in disease:
Subcellular Location: Mitochondrion outer membrane, Multi-pass membrane protein
Protein Families: Tom40 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O96008
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM