Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40) | CSB-EP024050HU

(No reviews yet) Write a Review
SKU:
CSB-EP024050HU
Availability:
3 - 7 Working Days
  • Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40) | CSB-EP024050HU | Cusabio

Alternative Name(s): Protein Haymaker Translocase of outer membrane 40KDA subunit homolog p38.5

Gene Names: TOMM40

Research Areas: Tags & Cell Markers

Organism: Homo sapiens (Human)

AA Sequence: MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-361aa

Sequence Info: Full Length

MW: 64.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication

Reference: "Sequencing of 42kb of the APO E-C2 gene cluster reveals a new gene: PEREC1." Freitas E.M., Zhang W.J., Lalonde J.P., Tay G.K., Gaudieri S., Ashworth L.K., Van Bockxmeer F.M., Dawkins R.L. DNA Seq. 9:89-100(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Channel-forming protein essential for import of protein precursors into mitochondria.

Involvement in disease:

Subcellular Location: Mitochondrion outer membrane, Multi-pass membrane protein

Protein Families: Tom40 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O96008

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose