Recombinant Mouse Triggering receptor expressed on myeloid cells 2 (Trem2), partial | CSB-EP024405MO

(No reviews yet) Write a Review
SKU:
CSB-EP024405MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Triggering receptor expressed on myeloid cells 2 (Trem2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Mouse Triggering receptor expressed on myeloid cells 2 (Trem2), partial | CSB-EP024405MO | Cusabio

Alternative Name(s): Short name: TREM-2 Alternative name(s): Triggering receptor expressed on monocytes 2

Gene Names: Trem2

Research Areas: Immunology

Organism: Mus musculus (Mouse)

AA Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 19-171aa

Sequence Info: Extracellular Domain

MW: 20.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells.

Reference: "Cloning and characterization of a novel mouse myeloid DAP12-associated receptor family."Daws M.R., Lanier L.L., Seaman W.E., Ryan J.C. Eur. J. Immunol. 31:783-791(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines.

Involvement in disease:

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted

Protein Families:

Tissue Specificity: Expressed at higher levels in the CNS, heart and lung than in lymph nodes or in other non-lymphoid tissues such as kidney, liver and testis. In the CNS not all microglia express TREM2. Brain regions with an incomplete blood-brain barrier had the lowest percentages of TREM2 expressing microglia, whereas the lateral entorhinal and cingulate cortex had the highest percentages.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q99NH8

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose