Recombinant Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase | CSB-EP313316EEA

Recombinant Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase | CSB-EP313316EEA | Cusabio

Alternative Name(s): ; Beta-glucosyl-HMC-alpha-glucosyl-transferase; EC 2.4.1.-

Gene Names: N/A

Research Areas: Others

Organism: Enterobacteria phage T6 (Bacteriophage T6)

AA Sequence: MIQFVIPSYQRVGAVSALDMFPTDYEPHIVVREHEEKAYNDAYGSRAKIITIPDGVNGIAGTRKAITDMYAGQRIWMIDDDTTIRMSSMRKRDDRRCVDKVNQLTHEQFYELIQYVEDAMDCGYYHGHARLPIFKITSSWGNYRENSYGFTNTWYDLGKLTTEQIGYGKIDLCEDMYAFLNLINQGYPHLALFKYLVVSGKAQAPGGCSSIRSNSKHNRALEQINREFPEQARWKTSNIEKRKSLGEEDEPLKVLRMCVSRKEKSEAFHKFNAIHPIAVD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-280aa

Sequence Info: Full Length

MW: 36.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Transfers a gentiobiosyl-group on a hydroxymethylcytosine residue in DNA. Is involved in a DNA modification process to protects the phage genome against its own nucleases and the host restriction endonuclease system.

Reference: "Cloning and sequencing of the genes of beta-glucosyl-HMC-alpha-glucosyl-transferases of bacteriophages T2 and T6." Winkler M., Rueger W. Nucleic Acids Res. 21:1500-1500(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transfers a gentiobiosyl-group on a hydroxymethylcytosine residue in DNA. Is involved in a DNA modification process to protects the phage genome against its own nucleases and the host restriction endonuclease system.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q06718

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A