Recombinant Salmonella typhimurium Invasion protein iagB (iagB) | CSB-EP315647SXB

(No reviews yet) Write a Review
SKU:
CSB-EP315647SXB
Availability:
13 - 23 Working Days
  • Recombinant Salmonella typhimurium Invasion protein iagB (iagB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Salmonella typhimurium Invasion protein iagB (iagB) | CSB-EP315647SXB | Cusabio

Alternative Name(s): iagB; STM2877Invasion protein IagB

Gene Names: iagB

Research Areas: Others

Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

AA Sequence: DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-160aa

Sequence Info: Full Length of Mature Protein

MW: 32 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2."McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. Wilson R.K.Nature 413:852-856(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: IagB/IpgF/P19 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CL15

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose