Human Recombinant

Recombinant Human Myosin-6 (MYH6), partial | CSB-YP015299HU | CusabioAlternative Name(s): Myosin heavy chain 6Myosin heavy chain, cardiac muscle alpha isoform ;MyHC-alphaGene Names: MYH6Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA...

Recombinant Human N-myc proto-oncogene protein (MYCN) | CSB-YP015278HU | CusabioAlternative Name(s): Class E basic helix-loop-helix protein 37 ;bHLHe37Gene Names: MYCNResearch Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Muscle, skeletal receptor tyrosine-protein kinase (MUSK), partial | CSB-YP015241HU | CusabioAlternative Name(s): Muscle-specific tyrosine-protein kinase receptor ;MuSK ;Muscle-specific kinase receptorGene Names: MUSKResearch Areas:...

Recombinant Human Mucin-2 (MUC2), partial | CSB-YP015222HU | CusabioAlternative Name(s): Intestinal mucin-2Gene Names: MUC2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Methylenetetrahydrofolate reductase (MTHFR) | CSB-YP015158HU | CusabioAlternative Name(s): 5 10 methylenetetrahydrofolate reductase (NADPH); 5 10 methylenetetrahydrofolate reductase; Methylenetetrahydrofolate reductase (NAD(P)H);...

Recombinant Human Metallothionein-2 (MT2A), partial | CSB-YP015120HU | CusabioAlternative Name(s): Metallothionein-2AMetallothionein-II ;MT-IIGene Names: MT2AResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Metallothionein-1X (MT1X), partial | CSB-YP015119HU | CusabioAlternative Name(s): Metallothionein-IX ;MT-IXGene Names: MT1XResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Metallothionein-1F (MT1F), partial | CSB-YP015112HU | CusabioAlternative Name(s): Metallothionein-IF ;MT-IFGene Names: MT1FResearch Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human B-lymphocyte antigen CD20 (MS4A1), partial | CSB-YP015007HU1 | CusabioAlternative Name(s): B-lymphocyte surface antigen B1Bp35Leukocyte surface antigen Leu-16Membrane-spanning 4-domains subfamily A member 1; CD20Gene Names:...

Recombinant Human MORF4 family-associated protein 1-like 1 (MRFAP1L1) | CSB-YP014790HU | CusabioAlternative Name(s): MORF4 family-associated protein 1-like 1; MR1L1_HUMAN; MRFAP1L1; PP784Gene Names: MRFAP1L1Research Areas: Cell BiologyOrganism: Homo...

Recombinant Human Macrophage mannose receptor 1 (MRC1), partial | CSB-YP014783HU | CusabioAlternative Name(s): C-type lectin domain family 13 member DC-type lectin domain family 13 member D-like;Macrophage mannose receptor 1-like protein 1; CD206Gene...

Recombinant Human Myelin protein P0 (MPZ), partial | CSB-YP014774HU | CusabioAlternative Name(s): Myelin peripheral protein ;MPPMyelin protein zeroGene Names: MPZResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Thrombopoietin receptor (MPL), partial | CSB-YP014755HU | CusabioAlternative Name(s): Myeloproliferative leukemia protein;Proto-oncogene c-Mpl; CD110Gene Names: MPLResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human DNA-3-methyladenine glycosylase (MPG), partial | CSB-YP014749HU | CusabioAlternative Name(s): 3-alkyladenine DNA glycosylase3-methyladenine DNA glycosidaseADPGN-methylpurine-DNA glycosylaseGene Names: MPGResearch Areas: Epigenetics and...

Recombinant Human Matrix metalloproteinase-9 (MMP9) , partial | CSB-YP014679HU | CusabioAlternative Name(s): 92KDA gelatinase92KDA type IV collagenaseGelatinase B ;GELBGene Names: MMP9Research Areas: Developmental BiologyOrganism: Homo sapiens (Human)AA...

Recombinant Human Stromelysin-2 (MMP10) | CSB-YP014657HU | CusabioAlternative Name(s): Matrix metalloproteinase-10 ;MMP-10Transin-2Gene Names: MMP10Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neprilysin (MME), partial | CSB-YP014653HU | CusabioAlternative Name(s): AtriopeptidaseCommon acute lymphocytic leukemia antigen ;CALLAEnkephalinaseNeutral endopeptidase 24.11 ;NEP ;Neutral endopeptidase;Skin fibroblast elastase ;SFE;...

Recombinant Human Proliferation marker protein Ki-67 (MKI67), partial | CSB-YP014597HU | CusabioAlternative Name(s): Antigen identified by monoclonal Ki 67 ; Antigen identified by monoclonal Ki-67; Antigen KI-67; Antigen KI67 ; Antigen Ki67; KI67_HUMAN;...

Recombinant Human Macrophage migration inhibitory factor (MIF) | CSB-YP013826HU | CusabioAlternative Name(s): Glycosylation-inhibiting factor Short name: GIF L-dopachrome isomerase L-dopachrome tautomerase (EC:5.3.3.12) Phenylpyruvate...

Recombinant Human Protein-methionine sulfoxide oxidase MICAL2 (MICAL2), partial | CSB-YP013808HU | CusabioAlternative Name(s): Molecule interacting with CasL protein 2 ;MICAL-2Gene Names: MICAL2Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA...

Recombinant Human Methionine aminopeptidase 2 (METAP2) | CSB-YP013716HU | CusabioAlternative Name(s): Initiation factor 2-associated 67KDA glycoproteinGene Names: METAP2Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Homeobox protein Meis1 (MEIS1), partial | CSB-YP013686HU | CusabioAlternative Name(s): Gene Names: MEIS1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Mannose-binding protein C (MBL2) | CSB-YP013540HU | CusabioAlternative Name(s): Collectin-1MBP1Mannan-binding protein;Mannose-binding lectinGene Names: MBL2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human S-adenosylmethionine synthase isoform type-2 (MAT2A) | CSB-YP013517HU | CusabioAlternative Name(s): S-adenosylmethionine synthase isoform type-2(AdoMet synthase 2)(EC 2.5.1.6)(Methionine adenosyltransferase 2)(MAT 2)(Methionine...

Recombinant Human Mannan-binding lectin serine protease 1 (MASP1) | CSB-YP013508HU | CusabioAlternative Name(s): Complement factor MASP-3 Complement-activating component of Ra-reactive factor Mannose-binding lectin-associated serine protease 1 Short...

Recombinant Human Melanoma-associated antigen 10 (MAGEA10) | CSB-YP013324HU | CusabioAlternative Name(s): Cancer/testis antigen 1.10Gene Names: MAGEA10Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Melanoma-associated antigen 1 (MAGEA1) | CSB-YP013323HU | CusabioAlternative Name(s): Antigen MZ2-ECancer/testis antigen 1.1 ;CT1.1MAGE-1 antigenGene Names: MAGEA1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Myelin-associated glycoprotein (MAG), partial | CSB-YP013322HU | CusabioAlternative Name(s): Siglec-4aGene Names: MAGResearch Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Lymphocyte antigen 6H (LY6H) | CSB-YP013249HU | CusabioAlternative Name(s): Short name: Ly-6HGene Names: LY6HResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) | CSB-YP013246HU | CusabioAlternative Name(s): Megakaryocyte-enhanced gene transcript 1 proteinGene Names: LY6G6DResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA...

Recombinant Human Low-density lipoprotein receptor-related protein 4 (LRP4), partial | CSB-YP013099HU | CusabioAlternative Name(s): Multiple epidermal growth factor-like domains 7Gene Names: LRP4Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Human Low-density lipoprotein receptor-related protein 2 (LRP2), partial | CSB-YP013096HU | CusabioAlternative Name(s): Glycoprotein 330 ;gp330MegalinGene Names: LRP2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Lysosomal acid lipase/cholesteryl ester hydrolase (LIPA) | CSB-YP012972HU | CusabioAlternative Name(s): Cholesteryl esterase Lipase A Sterol esteraseGene Names: LIPAResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA...

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5), partial | CSB-YP012937HU | CusabioAlternative Name(s): CD85 antigen-like family member FImmunoglobulin-like transcript 11 ;ILT-11Leukocyte immunoglobulin-like...

Recombinant Human Lutropin-choriogonadotropic hormone receptor (LHCGR), partial | CSB-YP012911HU | CusabioAlternative Name(s): Luteinizing hormone receptor ;LHR ;LSH-RGene Names: LHCGRResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 5 (LGR5), partial | CSB-YP012906HU | CusabioAlternative Name(s): G-protein coupled receptor 49G-protein coupled receptor 67G-protein coupled receptor HG38Gene Names: LGR5Research...

Recombinant Human Legumain (LGMN) | CSB-YP012903HU | CusabioAlternative Name(s): Asparaginyl endopeptidase Protease, cysteine 1Gene Names: LGMNResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Galectin-9 (LGALS9) | CSB-YP012895HU | CusabioAlternative Name(s): Ecalectin Tumor antigen HOM-HD-21Gene Names: LGALS9Research Areas: Cell Biology Organism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Plastin-2 (LCP1) | CSB-YP012824HU | CusabioAlternative Name(s): L-plastin;LC64PLymphocyte cytosolic protein 1 ;LCP-1Gene Names: LCP1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Neural cell adhesion molecule L1 protein (L1CAM), partial | CSB-YP012704HU | CusabioAlternative Name(s): CD171Gene Names: L1CAMResearch Areas: Cell AdhesionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Keratin, type II cuticular Hb5 (KRT85) | CSB-YP012580HU | CusabioAlternative Name(s): Hair keratin K2.12 (Keratin-85) (K85) (Type II hair keratin Hb5) (Type-II keratin Kb25) (KRTHB5)Gene Names: KRT85Research Areas: OthersOrganism: Homo...

Recombinant Human KeRatin, type II cytoskeletal 4 (KRT4) | CSB-YP012556HU | CusabioAlternative Name(s): Cytokeratin-4 ;CK-4Keratin-4 ;K4Type-II keratin Kb4Gene Names: KRT4Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human KeRatin, type I cytoskeletal 14 (KRT14) | CSB-YP012512HU | CusabioAlternative Name(s): Cytokeratin-14 ;CK-14Keratin-14 ;K14Gene Names: KRT14Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human KeRatin, type I cytoskeletal 10 (KRT10), partial | CSB-YP012504HU1 | CusabioAlternative Name(s): Cytokeratin-10 ;CK-10Keratin-10 ;K10Gene Names: KRT10Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kynurenine 3-monooxygenase (KMO) | CSB-YP012475HU | CusabioAlternative Name(s): Kynurenine 3-hydroxylaseGene Names: KMOResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Killer cell lectin-like receptor subfamily G member 2 (KLRG2) | CSB-YP012473HU | CusabioAlternative Name(s): C-type lectin domain family 15 member BGene Names: KLRG2Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Plasma kallikrein (KLKB1), partial | CSB-YP012461HU | CusabioAlternative Name(s): Fletcher factor Kininogenin Plasma prekallikreinGene Names: KLKB1Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kallikrein-7 (KLK7), partial | CSB-YP012458HU | CusabioAlternative Name(s): Serine protease 6Stratum corneum chymotryptic enzyme ;hSCCEGene Names: KLK7Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kinesin light chain 3 (KLC3) | CSB-YP012381HU | CusabioAlternative Name(s): KLC2-like kinesin light chain 2Gene Names: KLC3Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Kelch-like ECH-associated protein 1 (KEAP1) | CSB-YP012147HU | CusabioAlternative Name(s): Cytosolic inhibitor of Nrf2Gene Names: KEAP1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human) AA Sequence:...

Recombinant Human Lysine-specific demethylase 5A (KDM5A), partial | CSB-YP012141HU | CusabioAlternative Name(s): Histone demethylase JARID1AJumonji/ARID domain-containing protein 1ARetinoblastoma-binding protein 2 ;RBBP-2Gene Names: KDM5AResearch Areas:...

Recombinant Human Potassium channel subfamily K member 2 (KCNK2), partial | CSB-YP012070HU | CusabioAlternative Name(s): Outward rectifying potassium channel protein TREK-1 TREK-1 K(+) channel subunit Two pore domain potassium channel TREK-1 Two pore...

Recombinant Human ATP-sensitive inward rectifier potassium channel 1 (KCNJ1), partial | CSB-YP012047HU | CusabioAlternative Name(s): ATP-regulated potassium channel ROM-KInward rectifier K(+) channel Kir1.1;Potassium channel, inwardly rectifying...

Recombinant Human Potassium voltage-gated channel subfamily D member 2 (KCND2), partial | CSB-YP012023HU | CusabioAlternative Name(s): Voltage-gated potassium channel subunit Kv4.2Gene Names: KCND2Research Areas: TransportOrganism: Homo sapiens (Human)AA...

Recombinant Human Potassium voltage-gated channel subfamily D member 1 (KCND1), partial | CSB-YP012022HU | CusabioAlternative Name(s): Voltage-gated potassium channel subunit Kv4.1Gene Names: KCND1Research Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Junctional adhesion molecule B (JAM2), partial | CSB-YP011936HU | CusabioAlternative Name(s): Junctional adhesion molecule 2 ;JAM-2Vascular endothelial junction-associated molecule ;VE-JAM; CD322Gene Names: JAM2Research Areas:...

Recombinant Human Tyrosine-protein kinase JAK1 (JAK1), partial | CSB-YP011930HU | CusabioAlternative Name(s): Janus kinase 1 Short name: JAK-1Gene Names: JAK1Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Integrin alpha-V (ITGAV), partial | CSB-YP011877HU | CusabioAlternative Name(s): Vitronectin receptor subunit alpha; CD51Gene Names: ITGAVResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Integrin alpha-IIb (ITGA2B), partial | CSB-YP011865HU | CusabioAlternative Name(s): GPalpha IIb ;GPIIbPlatelet membrane glycoprotein IIb; CD41Gene Names: ITGA2BResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Integrin alpha-2 (ITGA2), partial | CSB-YP011864HU | CusabioAlternative Name(s): CD49 antigen-like family member B Collagen receptor Platelet membrane glycoprotein Ia Short name: GPIa VLA-2 subunit alpha CD_antigen: CD49bGene Names:...

Recombinant Human Ubiquitin-like protein ISG15 (ISG15) | CSB-YP011843HU | CusabioAlternative Name(s): Interferon-induced 15 kDa protein Interferon-induced 17 kDa protein Short name: IP17 Ubiquitin cross-reactive protein Short name: hUCRPGene Names:...

Recombinant Human Interleukin-8 (CXCL8), partial | CSB-YP011671HU | CusabioAlternative Name(s): C-X-C motif chemokine 8 Chemokine (C-X-C motif) ligand 8 Emoctakin Granulocyte chemotactic protein 1 Short name: GCP-1 Monocyte-derived neutrophil chemotactic...

Recombinant Human Interleukin-6 receptor subunit alpha (IL6R), partial | CSB-YP011665HU | CusabioAlternative Name(s): Interleukin 6 receptor, isoform CRA_aGene Names: IL6RResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-5 (IL5) | CSB-YP011662HU | CusabioAlternative Name(s): B-cell differentiation factor I Eosinophil differentiation factor T-cell replacing factor Short name: TRFGene Names: IL5Research Areas: ImmunologyOrganism: Homo sapiens...

Recombinant Human Interleukin-4 (IL4) | CSB-YP011659HU | CusabioAlternative Name(s): B-cell stimulatory factor 1 ;BSF-1Binetrakin;Lymphocyte stimulatory factor 1;PitrakinraGene Names: IL4Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA...

Recombinant Human Interleukin-32 (IL32) | CSB-YP011655HU | CusabioAlternative Name(s): Natural killer cells protein 4 Tumor necrosis factor alpha-inducing factorGene Names: IL32Research Areas: CytokineOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-2 (IL2) | CSB-YP011629HU | CusabioAlternative Name(s): T-cell growth factor ;TCGFINN: AldesleukinGene Names: IL2Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-1 alpha (IL1A) | CSB-YP011613HUc7 | CusabioAlternative Name(s): Hematopoietin-1 IL1F1Gene Names: IL1AResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interleukin-1 alpha (IL1A) | CSB-YP011613HU | CusabioAlternative Name(s): Hematopoietin-1 (IL-1 alpha) (IL1F1)Gene Names: IL1AResearch Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Insulin-like growth factor 1 receptor (IGF1R), partial | CSB-YP011087HU | CusabioAlternative Name(s): Insulin-like growth factor I receptor Short name: IGF-I receptorGene Names: IGF1RResearch Areas: Signal TransductionOrganism: Homo...

Recombinant Human Interferon gamma (IFNG) | CSB-YP011050HU | CusabioAlternative Name(s): Immune interferonGene Names: IFNGResearch Areas: Stem CellsOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-21 (IFNA21) | CSB-YP011039HU | CusabioAlternative Name(s): Interferon alpha-F ;LeIF FGene Names: IFNA21Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-14 (IFNA14) | CSB-YP011035HU | CusabioAlternative Name(s): Interferon alpha-H ;LeIF HInterferon lambda-2-HGene Names: IFNA14Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-10 (IFNA10) | CSB-YP011033HU | CusabioAlternative Name(s): Interferon alpha-6LInterferon alpha-C ;LeIF CGene Names: IFNA10Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Interferon alpha-inducible protein 6 (IFI6) | CSB-YP011016HU | CusabioAlternative Name(s): Interferon-induced protein 6-16 ;Ifi-6-16Gene Names: IFI6Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Alpha-L-iduronidase (IDUA) | CSB-YP011000HU | CusabioAlternative Name(s): IDUA; Alpha-L-iduronidase; EC 3.2.1.76Gene Names: IDUAResearch Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Indoleamine 2, 3-dioxygenase 2 (IDO2), partial | CSB-YP010997HU | CusabioAlternative Name(s): Indoleamine 2,3-dioxygenase-like protein 1Indoleamine-pyrrole 2,3-dioxygenase-like protein 1Gene Names: IDO2Research Areas:...

Recombinant Human Indoleamine 2, 3-dioxygenase 1 (IDO1) | CSB-YP010996HU | CusabioAlternative Name(s): Indoleamine-pyrrole 2,3-dioxygenaseGene Names: IDO1Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Islet cell autoantigen 1 (ICA1) | CSB-YP010947HU(F1) | CusabioAlternative Name(s): 69KDA islet cell autoantigen Short name: ICA69 Islet cell autoantigen p69 Short name: ICAp69 Short name: p69Gene Names: ICA1Research Areas:...

Recombinant Human Islet cell autoantigen 1 (ICA1), partial | CSB-YP010947HU | CusabioAlternative Name(s): 69KDA islet cell autoantigen ;ICA69Islet cell autoantigen p69 ;ICAp69 ;p69Gene Names: ICA1Research Areas: NeuroscienceOrganism: Homo sapiens...

Recombinant Human Islet amyloid polypeptide (IAPP), partial | CSB-YP010931HU | CusabioAlternative Name(s): PYY-IGene Names: IAPPResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYSource:...

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial | CSB-YP010883HU2 | CusabioAlternative Name(s): 5-HT-1D;5-HT1D;Serotonin 1D alpha receptor;5-HT-1D-alpha;Serotonin receptor 1DGene Names: HTR1DResearch Areas: OthersOrganism: Homo sapiens...

Recombinant Human Heat shock cognate 71 kDa protein (HSPA8) | CSB-YP010829HU | CusabioAlternative Name(s): Heat shock 70 kDa protein 8 (Lipopolysaccharide-associated protein 1) (LAP-1) (LPS-associated protein 1) (HSC70) (HSP73) (HSPA10)Gene Names:...

Recombinant Human Heat shock protein HSP 90-alpha (HSP90AA1), partial | CSB-YP010802HU1 | CusabioAlternative Name(s): Heat shock 86KDA ;HSP 86 ;HSP86Lipopolysaccharide-associated protein 2 ;LAP-2 ;LPS-associated protein 2Renal carcinoma antigen...

Recombinant Human Peroxisomal multifunctional enzyme type 2 (HSD17B4) | CSB-YP010774HU | CusabioAlternative Name(s): 17-beta-hydroxysteroid dehydrogenase 4 Short name: 17-beta-HSD 4 D-bifunctional protein Short name: DBP Multifunctional protein 2 Short...

Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2 (HSD11B2) | CSB-YP010765HU | CusabioAlternative Name(s): 11-beta-hydroxysteroid dehydrogenase type 2 ;11-DH2 ;11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II ;-HSD11 type...

Recombinant Human Homeobox protein Hox-B4 (HOXB4) | CSB-YP010664HU | CusabioAlternative Name(s): Homeobox protein Hox-2.6Homeobox protein Hox-2FGene Names: HOXB4Research Areas: TranscriptionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Homeobox protein Hox-A2 (HOXA2), partial | CSB-YP010652HU | CusabioAlternative Name(s): Homeobox protein Hox-1K (HOX1K)Gene Names: HOXA2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human HNRNPL protein (HNRNPL), partial | CSB-YP010612HU | CusabioAlternative Name(s): /Gene Names: HNRNPLResearch Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Heterogeneous nuclear ribonucleoproteins A2/B1 (HNRNPA2B1) | CSB-YP010602HU | CusabioAlternative Name(s): /Gene Names: HNRNPA2B1Research Areas: TranscriptionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human High mobility group protein B1 (Hmgb1), partial | CSB-YP010553HU | CusabioAlternative Name(s): High mobility group protein 1 Short name: HMG-1Gene Names: Hmgb1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens...

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G) | CSB-YP010509HU | CusabioAlternative Name(s): HLA G antigen (MHC class I antigen G) (HLA-6.0) (HLAG)Gene Names: HLA-GResearch Areas: ImmunologyOrganism: Homo sapiens...

Recombinant Human Hexokinase-1 (HK1) , partial | CSB-YP010468HU1 | CusabioAlternative Name(s): Brain form hexokinaseHexokinase type I ;HK IGene Names: HK1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Histidine decarboxylase (HDC) | CSB-YP010246HU | CusabioAlternative Name(s): DCHS_HUMAN; EC 4.1.1.22; HDC; Histidine decarboxylaseGene Names: HDCResearch Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Orexin receptor type 2 (HCRTR2), partial | CSB-YP010232HU | CusabioAlternative Name(s): Hypocretin receptor type 2Gene Names: HCRTR2Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Orexin receptor type 1 (HCRTR1) | CSB-YP010231HU1 | CusabioAlternative Name(s): Hypocretin receptor type 1Gene Names: HCRTR1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Hepatitis A virus cellular receptor 2 (HAVCR2), partial | CSB-YP010145HU | CusabioAlternative Name(s): T-cell immunoglobulin and mucin domain-containing protein 3 ;TIMD-3T-cell immunoglobulin mucin receptor 3 ;TIM-3T-cell membrane...

Recombinant Human Granzyme B (GZMB) | CSB-YP010082HU | CusabioAlternative Name(s): C11CTLA-1Cathepsin G-like 1 ;CTSGL1Cytotoxic T-lymphocyte proteinase 2 ;Lymphocyte proteaseFragmentin-2Granzyme-2Human lymphocyte protein ;HLPSECTT-cell serine protease...

Recombinant Human Glycophorin-A (GYPA), partial | CSB-YP010074HU | CusabioAlternative Name(s): MN sialoglycoprotein;PAS-2Sialoglycoprotein alpha; CD235aGene Names: GYPAResearch Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Glutathione S-transferase P (GSTP1) | CSB-YP009989HUb0 | CusabioAlternative Name(s): GST class-piGSTP1-1Gene Names: GSTP1Research Areas: MetabolismOrganism: Homo sapiens (Human)AA Sequence:...