Recombinant Human KeRatin, type I cytoskeletal 10 (KRT10), partial | CSB-YP012504HU1

Recombinant Human KeRatin, type I cytoskeletal 10 (KRT10), partial | CSB-YP012504HU1 | Cusabio

Alternative Name(s): Cytokeratin-10 ;CK-10Keratin-10 ;K10

Gene Names: KRT10

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: EQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 326-443aa

Sequence Info: Partial

MW: 15.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: The complete sequence of the human intermediate filament chain keratin 10. Subdomainal divisions and model for folding of end domain sequences.Zhou X.M., Idler W.W., Steven A.C., Roop D.R., Steinert P.M.J. Biol. Chem. 263:15584-15589(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease: Epidermolytic hyperkeratosis (EHK); Ichthyosis annular epidermolytic (AEI); Erythroderma, ichthyosiform, congenital reticular (CRIE)

Subcellular Location:

Protein Families: Intermediate filament family

Tissue Specificity: Seen in all suprabasal cell layers including stratum corneum.

Paythway: Estrogensignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13645

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM