null

Recombinant Human Junctional adhesion molecule B (JAM2), partial | CSB-YP011936HU

(No reviews yet) Write a Review
SKU:
CSB-YP011936HU
Availability:
25 - 35 Working Days
  • Recombinant Human Junctional adhesion molecule B (JAM2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€262.00 - €1,406.00
Frequently bought together:

Description

Recombinant Human Junctional adhesion molecule B (JAM2), partial | CSB-YP011936HU | Cusabio

Alternative Name(s): Junctional adhesion molecule 2 ;JAM-2Vascular endothelial junction-associated molecule ;VE-JAM; CD322

Gene Names: JAM2

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 29-238aa

Sequence Info: Extracellular Domain

MW: 25.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in the processes of lymphocyte homing to secondary lymphoid organs.

Reference: Vascular endothelial junction-associated molecule, a novel member of the immunoglobulin superfamily, is localized to intercellular boundaries of endothelial cells.Palmeri D., van Zante A., Huang C.-C., Hemmerich S., Rosen S.D.J. Biol. Chem. 275:19139-19145(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in the processes of lymphocyte homing to secondary lymphoid organs.

Involvement in disease:

Subcellular Location: Cell junction, tight junction, Cell membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily

Tissue Specificity: Highest expression in the heart, placenta, lung, foreskin and lymph node. Prominently expressed on high endothelial venules, also present on the endothelia of other vessels. Localized to the intercellular boundaries of high endothelial cells.

Paythway: Leukocytetransendothelialmigration

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P57087

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose