Cusabio Human Recombinants
Recombinant Human Orexin receptor type 2 (HCRTR2), partial | CSB-YP010232HU
- SKU:
- CSB-YP010232HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Orexin receptor type 2 (HCRTR2), partial | CSB-YP010232HU | Cusabio
Alternative Name(s): Hypocretin receptor type 2
Gene Names: HCRTR2
Research Areas: Cardiovascular
Organism: Homo sapiens (Human)
AA Sequence: MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYEWVLIAGYIIVFVVALIGNVLV
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-75aa
Sequence Info: Partial
MW: 10.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides.
Reference: "Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behavior." Sakurai T., Amemiya A., Ishii M., Matsuzaki I., Chemelli R.M., Tanaka H., Williams S.C., Richardson J.A., Kozlowski G.P., Wilson S., Arch J.R.S., Buckingham R.E., Haynes A.C., Carr S.A., Annan R.S., McNulty D.E., Liu W.-S., Terrett J.A. Yanagisawa M.Cell 92:573-585(1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides
Involvement in disease:
Subcellular Location: Cell membrane, Multi-pass membrane protein
Protein Families: G-protein coupled receptor 1 family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O43614
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM