Cusabio Active Proteins
Recombinant Mouse Sonic hedgehog protein (Shh), partial (Active) | CSB-AP005791MO
- SKU:
- CSB-AP005791MO
- Availability:
- 5 to 10 Working Days
Description
Recombinant Mouse Sonic hedgehog protein (Shh) ,partial (Active) | CSB-AP005791MO | Cusabio
Protein Description: Partial
Alternative Name (s) : Sonic Hedgehog Protein; SHH; HHG-1; SHH
Gene Names: Shh
Research Areas: Cancer
Species: Mus musculus (Mouse)
Source: E.coli
Tag Info: Tag-Free
Expression Region: 25-198aa
Sequence Info: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
Biological Activity: The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.
MW: 19.8 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Relevance: Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH) . Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa NÂterminal fragment (ShhÂN) , and a catalyticÂprocessing,glycosylated, 34 kDa, 239 aa CÂterminal fragment. The 20 kDa ShhÂN fragment is the core of the active hedgehog molecule. Mouse ShhÂN is 99%, 98%, and 100% aa identical to human, rat and gerbil ShhÂN, respectively.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function: Sonic hedgehog protein
Involvement in disease:
Subcellular Location: Sonic hedgehog protein N-product: Cell membrane, Lipid-anchor
Protein Families: Hedgehog family
Tissue Specificity: Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina.
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q62226
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A