Recombinant Mouse Sonic hedgehog protein (Shh), partial (Active) | CSB-AP005791MO

Recombinant Mouse Sonic hedgehog protein (Shh) ,partial (Active) | CSB-AP005791MO | Cusabio

Protein Description: Partial

Alternative Name (s) : Sonic Hedgehog Protein; SHH; HHG-1; SHH

Gene Names: Shh

Research Areas: Cancer

Species: Mus musculus (Mouse)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 25-198aa

Sequence Info: CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Biological Activity: The ED50 as determined by its ability to bind Human BOC in functional ELISA is less than 90 ug/ml.

MW: 19.8 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Mouse Sonic Hedgehog Homolog (SHH) belongs to a three-protein family called Hedgehog. The other two family members are Indian Hedgehog (IHH) and Desert Hedgehog (DHH) . Hedgehog proteins are key signaling molecules in embryonic development. SHH is expressed in various embryonic tissues and plays critical roles in regulating the patterning of many systems, such as limbs and brain. SHH also plays an important role in adult, including the division of adult stem cells and the development of certain cancers and other diseases.Mouse Shh is synthesized as a 437 aa precursor that contains a 24 aa signal sequence and a 413 aa mature region. The mature region is autocatalytically processed into a nonglycosylated, 20 kDa, 174 aa N­terminal fragment (Shh­N) , and a catalytic­processing,glycosylated, 34 kDa, 239 aa C­terminal fragment. The 20 kDa Shh­N fragment is the core of the active hedgehog molecule. Mouse Shh­N is 99%, 98%, and 100% aa identical to human, rat and gerbil Shh­N, respectively.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Sonic hedgehog protein

Involvement in disease:

Subcellular Location: Sonic hedgehog protein N-product: Cell membrane, Lipid-anchor

Protein Families: Hedgehog family

Tissue Specificity: Expressed in a number of embryonic tissues including the notochord, ventral neural tube, floor plate, lung bud, zone of polarizing activity and posterior distal mesenchyme of limbs. In the adult, expressed in lung and neural retina.

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 1 mM DTT, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q62226

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A