N-terminal 6xHis-SUMO-tagged Recombinant

Recombinant Neosartorya fumigata Major allergen Asp f 2 (AFUA_4G09580) | CSB-EP304434NGS | CusabioAlternative Name(s): Allergen Asp f II Allergen: Asp f 2Gene Names: AFUA_4G09580Research Areas: OthersOrganism: eosartorya fumigata (strain ATCC MYA-4609 /...

Recombinant Escherichia coli Periplasmic murein peptide-binding protein (mppA) | CSB-EP304378ENV | CusabioAlternative Name(s): mppA; ynaH; b1329; JW1322; Periplasmic murein peptide-binding proteinGene Names: mppAResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Cell division protein ZipA (zipA) | CSB-EP303519ENV | CusabioAlternative Name(s): zipA; b2412; JW2404; Cell division protein ZipA; FtsZ interacting protein AGene Names: zipAResearch Areas: OthersOrganism: Escherichia coli...

Recombinant Mycoplasma pneumoniae Uncharacterized lipoprotein MPN_083 (MPN_083), partial | CSB-EP303444MLW | CusabioAlternative Name(s): Uncharacterized lipoprotein MPN_083Gene Names: MPN_083Research Areas: MicrobiologyOrganism: Mycoplasma pneumoniae...

Recombinant Mycoplasma pneumoniae Putative Xaa-Pro aminopeptidase (pepP) | CSB-EP303407MLW | CusabioAlternative Name(s): Short name: X-Pro aminopeptidase Alternative name(s): Aminoacylproline aminopeptidase Aminopeptidase P Short name: APPGene Names:...

Recombinant Yersinia enterocolitica Heat-stable enterotoxin B (ystB) | CSB-EP303368YAQ | CusabioAlternative Name(s): Y-STBGene Names: ystBResearch Areas: OthersOrganism: Yersinia enterocoliticaAA Sequence: EENDDWCCEVCCNPACAGCSource: E.coliTag Info:...

Recombinant Escherichia coli Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB) | CSB-EP303206ENV | CusabioAlternative Name(s): Protein B2;Protein R2Ribonucleotide reductase 1Gene Names: nrdBResearch Areas: OthersOrganism: Escherichia coli...

Recombinant Escherichia coli Glutamate-pyruvate aminotransferase AlaC (alaC) | CSB-EP302867ENV | CusabioAlternative Name(s): alaC; yfdZ; b2379; JW2376; Glutamate-pyruvate aminotransferase AlaC; EC 2.6.1.2Gene Names: alaCResearch Areas: OthersOrganism:...

Recombinant Escherichia coli Bifunctional protein HldE (hldE) | CSB-EP302846ENV | CusabioAlternative Name(s): Including the following 2 domains: D-beta-D-heptose 7-phosphate kinase (EC:2.7.1.167) Alternative name(s): D-beta-D-heptose...

Recombinant Mycoplasma pneumoniae Probable cytosol aminopeptidase (pepA) | CSB-EP302719MLW | CusabioAlternative Name(s): Leucine aminopeptidase (EC:3.4.11.10) Short name: LAP Leucyl aminopeptidaseGene Names: pepAResearch Areas: MicrobiologyOrganism:...

Recombinant Enterobacteria phage M13 Tail virion protein G9P (IX) | CSB-EP301675ECY | CusabioAlternative Name(s): Coat protein C, polypeptide II G9PGene Names: IXResearch Areas: MicrobiologyOrganism: Enterobacteria phage M13 (Bacteriophage M13)AA...

Recombinant Mycoplasma pneumoniae Chaperone protein DnaK (dnaK) , partial | CSB-EP301110MLW | CusabioAlternative Name(s): HSP70 Heat shock 70KDA protein Heat shock protein 70Gene Names: dnaKResearch Areas: Signal TransductionOrganism: Mycoplasma...

Recombinant Enterobacteria phage H19B Shiga-like toxin 1 subunit B (stxB) | CSB-EP300809EKZ | CusabioAlternative Name(s): Verocytotoxin 1 subunit B ;Verotoxin 1 subunit BGene Names: stxBResearch Areas: OthersOrganism: Enterobacteria phage H19B...

Recombinant Bacillus subtilis Uncharacterized protein yuaB (yuaB) | CSB-EP300296BRJ | CusabioAlternative Name(s): ORF-1Gene Names: yuaBResearch Areas: MicrobiologyOrganism: Bacillus subtilis (strain 168)AA Sequence:...

Recombinant Yersinia pseudotuberculosis serotype I Yop proteins translocation protein M (yscM) | CSB-EP300275YAH | CusabioAlternative Name(s): Low calcium response locus protein QGene Names: yscMResearch Areas: MicrobiologyOrganism: Yersinia...

Recombinant Human MIG7 (MIG7) | CSB-EP2659HU | CusabioAlternative Name(s): /Gene Names: MIG7Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Dog Uncharacterized protein (DMP1) | CSB-EP2043DO | CusabioAlternative Name(s): /Gene Names: DMP1Research Areas: Signal Transduction Organism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Dog MMP13 protein (MMP13) | CSB-EP2042DO | CusabioAlternative Name(s): /Gene Names: MMP13Research Areas: CardiovascularOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA Sequence:...

Recombinant Penaeus monodon Sarcoplasmic calcium binding protein | CSB-EP2035ETF | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: CardiovascularOrganism: Penaeus monodon (Giant tiger prawn)AA Sequence:...

Recombinant Cyprinus carpio Parvalbumin (cyp c 1.02) | CSB-EP2033EQE | CusabioAlternative Name(s): /Gene Names: cyp c 1.02Research Areas: OthersOrganism: Cyprinus carpio (Common carp)AA Sequence:...

Recombinant Prunus persica Profilin | CSB-EP2032EZK | CusabioAlternative Name(s): Allergen: Pru p 4.02Gene Names: N/AResearch Areas: AllergenOrganism: Prunus persica (Peach) (Amygdalus persica)AA Sequence:...

Recombinant Prunus dulcis x Prunus persica Putative allergen Pru p 1.01 (Pru p 1.01) | CSB-EP2030EZJ | CusabioAlternative Name(s): /Gene Names: Pru p 1.01Research Areas: AllergenOrganism: Prunus dulcis x Prunus persicaAA Sequence:...

Recombinant Macaca fascicularis Myelin basic protein (EGM_08965) | CSB-EP2028MOV | CusabioAlternative Name(s): /Gene Names: EGM_08965Research Areas: NeuroscienceOrganism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)AA Sequence:...

Recombinant Clostridium botulinum Flagellin (CBO2730) | CSB-EP2027CWV | CusabioAlternative Name(s): /Gene Names: CBO2730Research Areas: MicrobiologyOrganism: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)AA Sequence:...

Recombinant Triticum aestivum Non-specific lipid-transfer protein | CSB-EP2021TQN | CusabioAlternative Name(s): Phospholipid transfer protein Short name: PLTPGene Names: N/AResearch Areas: OthersOrganism: Triticum aestivum (Wheat)AA Sequence:...

Recombinant Triticum aestivum Omega-5 gliadin, partial | CSB-EP2020TQN | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: OthersOrganism: Triticum aestivum (Wheat)AA Sequence:...

Recombinant Actinidia deliciosa Bet v 1 related allergen (ypr-10) | CSB-EP2017AXF | CusabioAlternative Name(s): /Gene Names: ypr-10Research Areas: OthersOrganism: Actinidia deliciosa (Kiwi)AA Sequence:...

Recombinant Corylus avellana 2S albuminImported | CSB-EP2016CBAD | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: AllergenOrganism: Corylus avellana (European hazel) (Corylus maxima)AA Sequence:...

Recombinant Staphylococcus aureus Extracellular enterotoxin type I (sei) | CSB-EP1905SUK | CusabioAlternative Name(s): /Gene Names: seiResearch Areas: Epigenetics and Nuclear SignalingOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Japanese encephalitis virus Genome polyprotein, partial | CSB-EP189574Ba | CusabioAlternative Name(s): /Gene Names: N/AResearch Areas: OthersOrganism: Japanese encephalitis virusAA Sequence:...

Recombinant Chlamydia pecorum Major outer membrane porin (ompA) | CSB-EP028238ZBR | CusabioAlternative Name(s): /Gene Names: ompAResearch Areas: OthersOrganism: Chlamydia pecorumAA Sequence:...

Recombinant Mouse Zinc finger protein 346 (Znf346) | CSB-EP026691MO | CusabioAlternative Name(s): Just another zinc finger proteinGene Names: Znf346Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse 14-3-3 protein zeta/delta (Ywhaz) | CSB-EP026293MO | CusabioAlternative Name(s): Protein kinase C inhibitor protein 1 Short name:KCIP-1 SEZ-2Gene Names: YwhazResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Protein Wnt-6 (Wnt6) | CSB-EP026140MO | CusabioAlternative Name(s): Protein Wnt-6Gene Names: Wnt6Research Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Proto-oncogene Wnt-3 (Wnt3) | CSB-EP026135MO | CusabioAlternative Name(s): Proto-oncogene Int-4Gene Names: Wnt3Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rabbit Vascular endothelial growth factor A (VEGFA) | CSB-EP025833RB | CusabioAlternative Name(s): /Gene Names: VEGFA Research Areas: OthersOrganism: Oryctolagus cuniculus (Rabbit)AA Sequence:...

Recombinant Pig Uricase (UOX) | CSB-EP025648PI | CusabioAlternative Name(s): Urate oxidaseGene Names: UOXResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...

Recombinant Human Nucleolar transcription factor 1 (UBTF), partial | CSB-EP025524HU1 | CusabioAlternative Name(s): Autoantigen NOR-90 Upstream-binding factor 1 Short name:UBF-1 UBFGene Names: UBTFResearch Areas: Epigenetics and Nuclear SignalingOrganism:...

Recombinant Acinetobacter baumannii Elongation factor Tu (tuf1) | CSB-EP025342AUD | CusabioAlternative Name(s): tuf1; A1S_0279;; tuf2; A1S_0869Elongation factor Tu; EF-TuGene Names: tuf1Research Areas: OthersOrganism: Acinetobacter baumannii (strain ATCC...

Recombinant Pongo abelii Transthyretin (TTR) | CSB-EP025270PYX | CusabioAlternative Name(s): PrealbuminGene Names: TTRResearch Areas: CardiovascularOrganism: Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)AA Sequence:...

Recombinant Mouse Transthyretin (Ttr), partial | CSB-EP025270MO1 | CusabioAlternative Name(s): PrealbuminGene Names: TtrResearch Areas: NeuroscienceOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Transthyretin (Ttr) | CSB-EP025270MO | CusabioAlternative Name(s): PrealbuminGene Names: TtrResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Alpha-tocopherol transfer protein (TTPA) | CSB-EP025268HU | CusabioAlternative Name(s): Alpha-TTPGene Names: TTPAResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Transient receptor potential cation channel subfamily A member 1 (TRPA1), partial | CSB-EP025074HU | CusabioAlternative Name(s): Ankyrin-like with transmembrane domains protein 1 Transformation-sensitive protein p120Gene Names:...

Recombinant Mouse Tryptophan 5-hydroxylase 1 (Tph1) | CSB-EP024100MO | CusabioAlternative Name(s): Tryptophan 5-monooxygenase 1Gene Names: Tph1Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Rat Trophoblast glycoprotein (Tpbg), partial | CSB-EP024093RA | CusabioAlternative Name(s): 5T4 oncofetal trophoblast glycoprotein Short name: 5T4 oncotrophoblast glycoprotein Wnt-activated inhibitory factor 1 Short name: WAIF1Gene Names:...

Recombinant Mouse Cellular tumor antigen p53 (Tp53) | CSB-EP024077MO | CusabioAlternative Name(s): Tumor suppressor p53Gene Names: Tp53Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Tumor necrosis factor ligand superfamily member 11 (Tnfsf11), partial | CSB-EP023986MO | CusabioAlternative Name(s): Osteoclast differentiation factor Short name:ODF Osteoprotegerin ligand Short name:OPGL Receptor activator of nuclear...

Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial | CSB-EP023981MO | CusabioAlternative Name(s): OX40 antigen OX40L receptor CD_antigen: CD134Gene Names: Tnfrsf4Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Tumor necrosis factor (Tnf), partial | CSB-EP023955MO1 | CusabioAlternative Name(s): Cachectin TNF-alpha Tumor necrosis factor ligand superfamily member 2 Short name:TNF-aGene Names: TnfResearch Areas: OthersOrganism: Mus musculus...

Recombinant Mouse Metalloproteinase inhibitor 1 (Timp1) | CSB-EP023560MO | CusabioAlternative Name(s): Collagenase inhibitor 16C8 fibroblastErythroid-potentiating activity ;EPATPA-S1TPA-induced protein;Tissue inhibitor of metalloproteinases 1 ;TIMP-1Gene...

Recombinant Mouse Thy-1 membrane glycoprotein (Thy1) | CSB-EP023525MO | CusabioAlternative Name(s): Thy-1 antigen CD_antigen: CD90Gene Names: Thy1Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Xenopus laevis Transforming growth factor beta-1 (tgfb1) | CSB-EP023446XBE | CusabioAlternative Name(s): Short name: TGF-beta-1 Alternative name(s): TGF-beta-5Gene Names: tgfb1Research Areas: Signal TransductionOrganism: Xenopus laevis...

Recombinant Rat Transforming growth factor beta-1 proprotein (Tgfb1), partial | CSB-EP023446RA | CusabioAlternative Name(s): Cleaved into the following chain: Latency-associated peptide Short name: LAPGene Names: Tgfb1Research Areas: Signal...

Recombinant Chicken Transforming growth factor beta-1 (TGFB1), partial | CSB-EP023446CH | CusabioAlternative Name(s): TGFB1; Transforming growth factor beta-1 proprotein [Cleaved into: Latency-associated peptide; LAP); Transforming growth factor beta-1;...

Recombinant Rat Thyroglobulin (Tg), partial | CSB-EP023442RA | CusabioAlternative Name(s): TgGene Names: TgResearch Areas: Signal TransductionOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Telomerase reverse transcriptase (Tert), partial | CSB-EP023391MO | CusabioAlternative Name(s): Telomerase catalytic subunitGene Names: TertResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant RatTryptophan 2, 3-dioxygenaseUniRule annotation (Tdo2) | CSB-EP023351RA | CusabioAlternative Name(s): Tryptamin 2,3-dioxygenase Tryptophan oxygenase Tryptophan pyrrolase TryptophanaseGene Names: Tdo2Research Areas: MetabolismOrganism: Rattus...

Recombinant Arabidopsis thaliana FACT complex subunit SPT16 (SPT16), partial | CSB-EP022955DOA | CusabioAlternative Name(s): Facilitates chromatin transcription complex subunit SPT16Gene Names: SPT16Research Areas: Developmental BiologyOrganism:...

Recombinant Human Erythrocyte band 7 integral membrane protein (STOM) | CSB-EP022862HU | CusabioAlternative Name(s): Protein 7.2b StomatinGene Names: STOMResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Serine racemase (SRR) | CSB-EP022691HU | CusabioAlternative Name(s): D-serine ammonia-lyase D-serine dehydratase L-serine ammonia-lyase L-serine dehydrataseGene Names: SRRResearch Areas: NeuroscienceOrganism: Homo sapiens (Human)AA...

Recombinant Human Spectrin alpha chain, non-erythrocytic 1 (SPTAN1), partial | CSB-EP022633HU | CusabioAlternative Name(s): Alpha-II spectrin Fodrin alpha chain Spectrin, non-erythroid alpha subunitGene Names: SPTAN1Research Areas: Signal...

Recombinant Rat Sortilin (Sort1), partial | CSB-EP022412RA | CusabioAlternative Name(s): Glycoprotein 110 ;Gp110Neurotensin receptor 3 ;NTR3Gene Names: Sort1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Suppressor of cytokine signaling 3 (Socs3) | CSB-EP022392RA | CusabioAlternative Name(s): Cytokine-inducible SH2 protein 3Gene Names: Socs3Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) | CSB-EP021912MOV | CusabioAlternative Name(s): SNCA; Alpha-synucleinGene Names: SNCAResearch Areas: OthersOrganism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)AA Sequence:...

Recombinant Mouse Spermine oxidase (Smox) | CSB-EP021844MO | CusabioAlternative Name(s): Polyamine oxidase 1 ;PAO-1 ;PAOh1Gene Names: SmoxResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Large neutral amino acids transporter small subunit 1 (SLC7A5), partial | CSB-EP021717HUa3 | CusabioAlternative Name(s): 4F2 light chain Short name: 4F2 LC Short name: 4F2LC CD98 light chain Integral membrane protein E16 Short...

Recombinant Human Transformer-2 protein homolog beta (TRA2B), partial | CSB-EP021143HU1 | CusabioAlternative Name(s): Splicing factor, arginine/serine-rich 10 (Transformer-2 protein homolog B) (SFRS10)Gene Names: TRA2BResearch Areas: Epigenetics and...

Recombinant Mouse Serpin H1 (Serpinh1) | CSB-EP021087MO | CusabioAlternative Name(s): 47KDA heat shock protein Collagen-binding protein Short name: Colligin Serine protease inhibitor J6Gene Names: Serpinh1Research Areas: OthersOrganism: Mus musculus...

Recombinant Rat Plasminogen activator inhibitor 1 (Serpine1) | CSB-EP021081RA | CusabioAlternative Name(s): Endothelial plasminogen activator inhibitorSerpin E1Gene Names: Serpine1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Plasminogen activator inhibitor 1 (Serpine1) | CSB-EP021081MO | CusabioAlternative Name(s): Endothelial plasminogen activator inhibitorSerpin E1Gene Names: Serpine1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Serpin B4 (SERPINB4) | CSB-EP021072HU | CusabioAlternative Name(s): Leupin Peptidase inhibitor 11 Short name: PI-11 Squamous cell carcinoma antigen 2 Short name: SCCA-2Gene Names: SERPINB4Research Areas: CancerOrganism: Homo sapiens...

Recombinant Rat Plasminogen activator inhibitor 2 type A (Serpinb2) | CSB-EP021070RA | CusabioAlternative Name(s): Serpin B2Gene Names: Serpinb2Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Rat Alpha-1-antiproteinase (Serpina1) | CSB-EP021053RA | CusabioAlternative Name(s): Alpha-1 protease inhibitorAlpha-1-antiproteinase;Serpin A1Gene Names: Serpina1Research Areas: ImmunologyOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 (Aimp1) | CSB-EP020871MO | CusabioAlternative Name(s): Multisynthase complex auxiliary component p43 Cleaved into the following chain: Endothelial monocyte-activating...

Recombinant Mouse Serum amyloid A-1 protein (Saa1) | CSB-EP020656MO | CusabioAlternative Name(s): Saa1; Serum amyloid A-1 proteinGene Names: Saa1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Bovine Serum amyloid A protein (SAA1) | CSB-EP020656BO | CusabioAlternative Name(s): Amyloid fibril protein AA (SAA)Gene Names: SAA1Research Areas: CardiovascularOrganism: Bos taurus (Bovine)AA Sequence:...

Recombinant Rat Protein S100-A9 (S100a9) | CSB-EP020642RA | CusabioAlternative Name(s): Calgranulin-B Migration inhibitory factor-related protein 14 Short name:MRP-14 Short name:p14 Myeloid-related protein 14 S100 calcium-binding protein A9Gene Names:...

Recombinant Mouse Protein S100-A9 (S100a9) | CSB-EP020642MO | CusabioAlternative Name(s): Calgranulin-BLeukocyte L1 complex heavy chain;Migration inhibitory factor-related protein 14 ;MRP-14 ;p14S100 calcium-binding protein A9Gene Names: S100a9Research...

Recombinant Mouse Protein S100-A8 (S100a8) | CSB-EP020641MO | CusabioAlternative Name(s): Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain;Migration inhibitory factor-related protein 8 ;MRP-8 ;p8Pro-inflammatory S100 cytokine;S100...

Recombinant Human 40S ribosomal protein S3 (RPS3) | CSB-EP020443HU | CusabioAlternative Name(s): 40S ribosomal protein S3; fb13d09; FLJ26283; FLJ27450; IMR 90 ribosomal protein S3; MGC56088; MGC87870; OTTHUMP00000229804; OTTHUMP00000229805;...

Recombinant Human Rhodopsin (RHO), partial | CSB-EP019681HU | CusabioAlternative Name(s): Opsin-2Gene Names: RHOResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence: MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQSource: E.coliTag Info:...

Recombinant Mouse Ras-related protein Rab-10 (Rab10) | CSB-EP019152MO | CusabioAlternative Name(s): Rab10; Ras-related protein Rab-10Gene Names: Rab10Research Areas: Signal Transduction Organism: Mus musculus (Mouse)AA Sequence:...

Recombinant Escherichia coli Phosphoserine phosphatase (serB) | CSB-EP018938ENV | CusabioAlternative Name(s): O-phosphoserine phosphohydrolaseGene Names: serBResearch Areas: OthersOrganism: Escherichia coli (strain K12)AA Sequence:...

Recombinant Mouse Enteropeptidase (Tmprss15), partial | CSB-EP018824MO | CusabioAlternative Name(s): Enterokinase Serine protease 7 Transmembrane protease serine 15 Cleaved into the following 2 chains: Enteropeptidase non-catalytic heavy...

Recombinant Human Neurotrypsin (PRSS12) , partial | CSB-EP018812HU | CusabioAlternative Name(s): Leydin Motopsin Serine protease 12Gene Names: PRSS12Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Rat Anionic trypsin-1 (Prss1) | CSB-EP018811RA | CusabioAlternative Name(s): Anionic trypsin IPretrypsinogen ISerine protease 1Gene Names: Prss1Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA Sequence:...

Recombinant Mouse Prominin-1 (Prom1), Partial | CSB-EP018751MO | CusabioAlternative Name(s): Antigen AC133 homolog Prominin-like protein 1 CD_antigen: CD133Gene Names: Prom1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Pig Prolactin (PRL) | CSB-EP018724PI | CusabioAlternative Name(s): PRL; Prolactin; PRLGene Names: PRLResearch Areas: OthersOrganism: Sus scrofa (Pig)AA Sequence:...

Recombinant Mouse Peroxisome proliferator-activated receptor gamma (Pparg) | CSB-EP018424MO | CusabioAlternative Name(s): Nuclear receptor subfamily 1 group C member 3Gene Names: PpargResearch Areas: Epigenetics and Nuclear SignalingOrganism: Mus...

Recombinant Human Paraneoplastic antigen Ma2 (PNMA2), partial | CSB-EP018267HUa2 | CusabioAlternative Name(s): 40KDA neuronal protein Onconeuronal antigen Ma2 Paraneoplastic neuronal antigen MM2Gene Names: PNMA2Research Areas: Tags & Cell...

Recombinant Dog Inactive pancreatic lipase-related protein 1 (PNLIPRP1) | CSB-EP018263DO | CusabioAlternative Name(s): Short name:PL-RP1Gene Names: PNLIPRP1Research Areas: Signal TransductionOrganism: Canis lupus familiaris (Dog) (Canis familiaris)AA...

Recombinant Rat Calcium-dependent phospholipase A2 (Pla2g5) | CSB-EP018103RA | CusabioAlternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5Gene Names: Pla2g5Research Areas: OthersOrganism: Rattus norvegicus (Rat)AA...

Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5) | CSB-EP018103MO | CusabioAlternative Name(s): Group V phospholipase A2;PLA2-10Phosphatidylcholine 2-acylhydrolase 5Gene Names: Pla2g5Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant mouse platelet factor 4 (Pf4) | CSB-EP017809MO | CusabioAlternative Name(s): C-X-C motif chemokine 4Gene Names: Pf4Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Pyridoxal phosphate phosphatase (Pdxp) | CSB-EP017749MO | CusabioAlternative Name(s): PLP phosphatase Alternative name(s): ChronophinGene Names: PdxpResearch Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Protein disulfide-isomerase A2 (Pdia2) | CSB-EP017719MO | CusabioAlternative Name(s): Pdia2; Pdip; Protein disulfide-isomerase A2; EC 5.3.4.1; PDIpGene Names: Pdia2Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Staphylococcus aureus Peptide deformylase (def) | CSB-EP017707FKZ | CusabioAlternative Name(s): Polypeptide deformylaseGene Names: defResearch Areas: OthersOrganism: Staphylococcus aureusAA Sequence:...

Recombinant Escherichia coli O157:H7 Peptide deformylase (def) | CSB-EP017707EOD | CusabioAlternative Name(s): Polypeptide deformylaseGene Names: defResearch Areas: OthersOrganism: Escherichia coli O157:H7AA Sequence:...

Recombinant Mouse Proprotein convertase subtilisin/kexin type 5 (Pcsk5) | CSB-EP017644MO | CusabioAlternative Name(s): Proprotein convertase 5 ;PC5Proprotein convertase 6 ;PC6Subtilisin-like proprotein convertase 6 ;SPC6Subtilisin/kexin-like protease...