null

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) | CSB-EP021912MOV

(No reviews yet) Write a Review
SKU:
CSB-EP021912MOV
Availability:
3 - 7 Working Days
  • Recombinant Macaca fascicularis Alpha-synuclein (SNCA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Macaca fascicularis Alpha-synuclein (SNCA) | CSB-EP021912MOV | Cusabio

Alternative Name(s): SNCA; Alpha-synuclein

Gene Names: SNCA

Research Areas: Others

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-140aa

Sequence Info: Full Length

MW: 30.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in the regulation of dopamine release and transport.

Reference: Alpha-synuclein A53T substitution associated with Parkinson disease also marks the divergence of Old World and New World primates.Hamilton B.A.Genomics 83:739-742(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in the regulation of dopamine release and transport.

Involvement in disease:

Subcellular Location: Cytoplasm, cytosol, Membrane, Nucleus, Cell junction, synapse, Secreted

Protein Families: Synuclein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P61142

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose