null

Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial | CSB-EP467284TOV1

(No reviews yet) Write a Review
SKU:
CSB-EP467284TOV1
Availability:
3 - 7 Working Days
  • Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial | CSB-EP467284TOV1 | Cusabio

Alternative Name(s): P30

Gene Names: GRA3

Research Areas: Signal Transduction

Organism: Toxoplasma gondii

AA Sequence: ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 43-114aa

Sequence Info: Partial

MW: 10.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM.

Reference: "Interaction between parasitophorous vacuolar membrane-associated GRA3 and calcium modulating ligand of host cell endoplasmic reticulum in the parasitism of Toxoplasma gondii." Kim J.Y., Ahn H.J., Ryu K.J., Nam H.W. Korean J. Parasitol. 46:209-216(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B6KEU8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose