Cusabio Toxoplasma gondii Recombinants
Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial | CSB-EP467284TOV1
- SKU:
- CSB-EP467284TOV1
- Availability:
- 3 - 7 Working Days
Description
Recombinant Toxoplasma gondii Dense granule protein 3 (GRA3), partial | CSB-EP467284TOV1 | Cusabio
Alternative Name(s): P30
Gene Names: GRA3
Research Areas: Signal Transduction
Organism: Toxoplasma gondii
AA Sequence: ADQPENHQALAEPVTGVGEAGVSPVNEAGESYSSATSGVQEATAPGAVLLDAIDAESDKVDNQAEGGERMKK
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 43-114aa
Sequence Info: Partial
MW: 10.8 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Direct host-parasite interaction occurs at the cytoplasmic faces of the parasitophorous vacuole membrane (PVM) and the host endoplasmic reticulum (ER) membrane via GRA3 and host CAMLG association. Direct insertion of GRA3 ER retrieval motif into the host ER membrane contributes to the host ER recruitment to the PVM.
Reference: "Interaction between parasitophorous vacuolar membrane-associated GRA3 and calcium modulating ligand of host cell endoplasmic reticulum in the parasitism of Toxoplasma gondii." Kim J.Y., Ahn H.J., Ryu K.J., Nam H.W. Korean J. Parasitol. 46:209-216(2008)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: B6KEU8
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A