Recombinant Salmonella typhi Outer membrane protein S1 (ompS1) | CSB-EP687916SWW

(No reviews yet) Write a Review
SKU:
CSB-EP687916SWW
Availability:
13 - 23 Working Days
  • Recombinant Salmonella typhi Outer membrane protein S1 (ompS1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Salmonella typhi Outer membrane protein S1 (ompS1) | CSB-EP687916SWW | Cusabio

Alternative Name(s): ompS1; ompS; STY2203; t0883; Outer membrane protein S1

Gene Names: ompS1

Research Areas: Others

Organism: Salmonella typhi

AA Sequence: AEIYNKNGNKLDLYGKVDGLRYFSDNAGDDGDQSYARIGFKGETQINDMLTGYGQWEYNIKVNTTEGEGANSWTRLGFAGLKFGEYGSFDYGRNYGVIYDIEAWTDALPEFGGDTYTQTDVYMLGRTNGVATYRNTDFFGLVEGLNFALQYQGNNENGGAGAGEGTGNGGNRKLARENGDGFGMSTSYDFDFGLSLGAAYSSSDRSDNQVARGYGDGMNERNNYAGGETAEAWTIGAKYDAYNVYLAAMYAETRNMTYYGGGNGEGNGSIANKTQNFEVVAQYQFDFGLRPSIAYLQSKGKDLGGQEVHRGNWRYTDKDLVKYVDVGMTYYFNKNMSTYVDYKINLLDEDDDFYANNGIATDDIVGVGLVYQF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-394aa

Sequence Info: Full Length of Mature Protein

MW: 57.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Forms pores that allow passive diffusion of small molecules across the outer membrane.

Reference: "Isolation and characterization of ompS1, a novel Salmonella typhi outer membrane protein-encoding gene."Fernandez-Mora M., Oropeza R., Puente J.L., Calva E.Gene 158:67-72(1995)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Forms pores that allow passive diffusion of small molecules across the outer membrane.

Involvement in disease:

Subcellular Location: Cell outer membrane, Multi-pass membrane protein

Protein Families: Gram-negative porin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q56110

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose