Cusabio Salmonella typhi Recombinants
Recombinant Salmonella typhi Universal stress protein A (uspA) | CSB-YP820596SWW
- SKU:
- CSB-YP820596SWW
- Availability:
- 25 - 35 Working Days
Description
Recombinant Salmonella typhi Universal stress protein A (uspA) | CSB-YP820596SWW | Cusabio
Alternative Name(s): uspA; STY4212; t3925; Universal stress protein A
Gene Names: uspA
Research Areas: Microbiology
Organism: Salmonella typhi
AA Sequence: AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 2-144aa
Sequence Info: Full Length of Mature Protein
MW: 17.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Required for resistance to DNA-damaging agents.
Reference: "Comparative genomics of Salmonella enterica serovar Typhi strains Ty2 and CT18."Deng W., Liou S.-R., Plunkett G. III, Mayhew G.F., Rose D.J., Burland V., Kodoyianni V., Schwartz D.C., Blattner F.R.J. Bacteriol. 185:2330-2337(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Required for resistance to DNA-damaging agents.
Involvement in disease:
Subcellular Location: Cytoplasm
Protein Families: Universal stress protein A family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q8Z268
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A