Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD) | CSB-EP334291SXB

(No reviews yet) Write a Review
SKU:
CSB-EP334291SXB
Availability:
3 - 7 Working Days
  • Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD) | CSB-EP334291SXB | Cusabio

Alternative Name(s): ompD; nmpC; STM1572; Outer membrane porin protein OmpD

Gene Names: ompD

Research Areas: Others

Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

AA Sequence: AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-362aa

Sequence Info: Full Length of Mature Protein

MW: 53.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Forms pores that allow passive diffusion of small molecules across the outer mbrane.

Reference: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. , Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Forms pores that allow passive diffusion of small molecules across the outer membrane.

Involvement in disease:

Subcellular Location: Cell outer membrane, Multi-pass membrane protein

Protein Families: Gram-negative porin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P37592

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose