Cusabio Salmonella typhimurium Recombinants
Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD) | CSB-EP334291SXB
- SKU:
- CSB-EP334291SXB
- Availability:
- 3 - 7 Working Days
Description
Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD) | CSB-EP334291SXB | Cusabio
Alternative Name(s): ompD; nmpC; STM1572; Outer membrane porin protein OmpD
Gene Names: ompD
Research Areas: Others
Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
AA Sequence: AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 22-362aa
Sequence Info: Full Length of Mature Protein
MW: 53.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Forms pores that allow passive diffusion of small molecules across the outer mbrane.
Reference: Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. , Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R., Wilson R.K.Nature 413:852-856(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Forms pores that allow passive diffusion of small molecules across the outer membrane.
Involvement in disease:
Subcellular Location: Cell outer membrane, Multi-pass membrane protein
Protein Families: Gram-negative porin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P37592
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A