Cusabio Salmonella typhi Recombinants
Recombinant Salmonella typhi Outer membrane protein S1 (ompS1) | CSB-EP687916SWW
- SKU:
- CSB-EP687916SWW
- Availability:
- 13 - 23 Working Days
Description
Recombinant Salmonella typhi Outer membrane protein S1 (ompS1) | CSB-EP687916SWW | Cusabio
Alternative Name(s): ompS1; ompS; STY2203; t0883; Outer membrane protein S1
Gene Names: ompS1
Research Areas: Others
Organism: Salmonella typhi
AA Sequence: AEIYNKNGNKLDLYGKVDGLRYFSDNAGDDGDQSYARIGFKGETQINDMLTGYGQWEYNIKVNTTEGEGANSWTRLGFAGLKFGEYGSFDYGRNYGVIYDIEAWTDALPEFGGDTYTQTDVYMLGRTNGVATYRNTDFFGLVEGLNFALQYQGNNENGGAGAGEGTGNGGNRKLARENGDGFGMSTSYDFDFGLSLGAAYSSSDRSDNQVARGYGDGMNERNNYAGGETAEAWTIGAKYDAYNVYLAAMYAETRNMTYYGGGNGEGNGSIANKTQNFEVVAQYQFDFGLRPSIAYLQSKGKDLGGQEVHRGNWRYTDKDLVKYVDVGMTYYFNKNMSTYVDYKINLLDEDDDFYANNGIATDDIVGVGLVYQF
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 22-394aa
Sequence Info: Full Length of Mature Protein
MW: 57.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Forms pores that allow passive diffusion of small molecules across the outer membrane.
Reference: "Isolation and characterization of ompS1, a novel Salmonella typhi outer membrane protein-encoding gene."Fernandez-Mora M., Oropeza R., Puente J.L., Calva E.Gene 158:67-72(1995)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Forms pores that allow passive diffusion of small molecules across the outer membrane.
Involvement in disease:
Subcellular Location: Cell outer membrane, Multi-pass membrane protein
Protein Families: Gram-negative porin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q56110
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A