Cusabio Mouse Recombinants
Recombinant Mouse Versican core protein (Vcan), partial | CSB-EP720284MO
- SKU:
- CSB-EP720284MO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Mouse Versican core protein (Vcan), partial | CSB-EP720284MO | Cusabio
Alternative Name(s): Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2) (Large fibroblast proteoglycan) (PG-M) (Cspg2)
Gene Names: Vcan
Research Areas: Signal Transduction
Organism: Mus musculus (Mouse)
AA Sequence: AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 24-146aa
Sequence Info: Partial
MW: 20.9 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Reference: "Selective activation of the versican promoter by epithelial- mesenchymal interactions during hair follicle development." Kishimoto J., Ehama R., Wu L., Jiang S., Jiang N., Burgeson R.E. Proc. Natl. Acad. Sci. U.S.A. 96:7336-7341(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Involvement in disease:
Subcellular Location: Secreted, extracellular space, extracellular matrix
Protein Families: Aggrecan/versican proteoglycan family
Tissue Specificity: Isoform V2 is found only in brain.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q62059
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: N/A
STRING Database Link: STRING
OMIM Database Link: N/A