Recombinant Mouse Membrane cofactor protein (Cd46) , partial | CSB-EP004939MO

Recombinant Mouse Membrane cofactor protein (Cd46) , partial | CSB-EP004939MO | Cusabio

Alternative Name(s): CD46

Gene Names: Cd46

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: CELPRPFEAMELKGTPKLFYAVGEKIEYKCKKGYLYLSPYLMIATCEPNHTWVPISDAGCIKVQCTMLQDPSFGKVYYIDGSFSWGARAKFTCMEGYYVVGMSVLHCVLKGDDEAYWNGYPPHCEKIYCLPPPKIKNGTHTLTDINVFKYHEAVSYSCDPTPGPDKFSLVGTSMIFCAGHNTWSNSPPECKVVKCPNPVLQNGRLISGAGEIFSYQSTVMFECLQGFYMEGSSMVICSANNSWEPSIPKCLKGPRPTHPTKPPVYNYTGYPSPREGIFSQELDAW

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 45-329aa

Sequence Info: Extracellular Domain

MW: 35.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Reference: Disruption of mouse CD46 causes an accelerated spontaneous acrosome reaction in sperm.Inoue N., Ikawa M., Nakanishi T., Matsumoto M., Nomura M., Seya T., Okabe M.Mol. Cell. Biol. 23:2614-2622(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Involvement in disease:

Subcellular Location: Isoform 1: Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane, Single-pass type I membrane protein

Protein Families:

Tissue Specificity: Present only in testis (at protein level).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O88174

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A