Recombinant Human Versican core protein (VCAN), partial | CSB-EP025810HU(A5)

(No reviews yet) Write a Review
SKU:
CSB-EP025810HU(A5)
Availability:
3 - 7 Working Days
  • Recombinant Human Versican core protein (VCAN), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€266.00 - €1,440.00

Description

Recombinant Human Versican core protein (VCAN), partial | CSB-EP025810HU(A5) | Cusabio

Alternative Name(s): Chondroitin sulfate proteoglycan core protein 2

Gene Names: VCAN

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMN

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

Expression Region: 3089-3354aa

Sequence Info: Partial

MW: 47.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Reference: "A novel glycosaminoglycan attachment domain identified in two alternative splice variants of human versican." Dours-Zimmermann M.T., Zimmermann D.R. J. Biol. Chem. 269:32992-32998(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Involvement in disease: Wagner vitreoretinopathy (WGVRP)

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Aggrecan/versican proteoglycan family

Tissue Specificity: Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13611

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose