Recombinant Mouse Versican core protein (Vcan), partial | CSB-EP720284MO

(No reviews yet) Write a Review
SKU:
CSB-EP720284MO
Availability:
3 - 7 Working Days
  • Recombinant Mouse Versican core protein (Vcan), partial
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720284MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720284MO could indicate that this peptide derived from E.coli-expressed
€352.00 - €878.00

Description

Recombinant Mouse Versican core protein (Vcan), partial | CSB-EP720284MO | Cusabio

Alternative Name(s): Chondroitin sulfate proteoglycan core protein 2 (Chondroitin sulfate proteoglycan 2) (Large fibroblast proteoglycan) (PG-M) (Cspg2)

Gene Names: Vcan

Research Areas: Signal Transduction

Organism: Mus musculus (Mouse)

AA Sequence: AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 24-146aa

Sequence Info: Partial

MW: 20.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Reference: "Selective activation of the versican promoter by epithelial- mesenchymal interactions during hair follicle development." Kishimoto J., Ehama R., Wu L., Jiang S., Jiang N., Burgeson R.E. Proc. Natl. Acad. Sci. U.S.A. 96:7336-7341(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.

Involvement in disease:

Subcellular Location: Secreted, extracellular space, extracellular matrix

Protein Families: Aggrecan/versican proteoglycan family

Tissue Specificity: Isoform V2 is found only in brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q62059

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose