Recombinant Mouse Sex-determining region Y protein (Sry), partial | CSB-EP022699MO

(No reviews yet) Write a Review
SKU:
CSB-EP022699MO
Availability:
13 - 23 Working Days
  • Recombinant Mouse Sex-determining region Y protein (Sry), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Mouse Sex-determining region Y protein (Sry), partial | CSB-EP022699MO | Cusabio

Alternative Name(s): Testis-determining factor

Gene Names: Sry

Research Areas: Others

Organism: Mus musculus (Mouse)

AA Sequence: MEGHVKRPMNAFMVWSRGERHKLAQQNPSMQNTEISKQLGCRWKSLTEAEKRPFFQEAQRLKILHREKYPNYKYQPHRRAKVSQRSGILQPAVASTKLYNLLQWDRNPHAITYRQDWSRAAHLYSKNQQSFYWQPVDIPTGHLQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-144aa

Sequence Info: Partial

MW: 21.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons . Involved in different aspects of gene regulation including promoter activation or repression. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Promotes DNA bending. Also involved in pre-mRNA splicing . Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'.1 Publication

Reference: Evidence that Sry is expressed in pre-Sertoli cells and Sertoli and granulosa cells have a common precursor.Albrecht K.H., Eicher E.M.Dev. Biol. 240:92-107(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transcriptional regulator that controls a genetic switch in male development. It is necessary and sufficient for initiating male sex determination by directing the development of supporting cell precursors (pre-Sertoli cells) as Sertoli rather than granulosa cells. In male adult brain involved in the maintenance of motor functions of dopaminergic neurons (By similarity). Involved in different aspects of gene regulation including promoter activation or repression. SRY HMG box recognizes DNA by partial intercalation in the minor groove. Promotes DNA bending. Also involved in pre-mRNA splicing (By similarity). Binds to the DNA consensus sequence 5'-[AT]AACAA[AT]-3'.

Involvement in disease:

Subcellular Location: Nucleus speckle, Cytoplasm, Nucleus

Protein Families: SRY family

Tissue Specificity: Expressed in the substantia nigra of the brain (at protein level). Expressed in diencephalon, cortex, the substantia nigra of the midbrain and the medial mammillary bodies of the hypothalamus of male, but not female.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q05738

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose