null

Recombinant Mouse Pro-neuropeptide Y (Npy), partial | CSB-YP016034MO

(No reviews yet) Write a Review
SKU:
CSB-YP016034MO
Availability:
25 - 35 Working Days
€383.00 - €2,023.00
Frequently bought together:

Description

Recombinant Mouse Pro-neuropeptide Y (Npy), partial | CSB-YP016034MO | Cusabio

Alternative Name(s): Pro-neuropeptide Y [Cleaved into: Neuropeptide Y(Neuropeptide tyrosine)(NPY); C-flanking peptide of NPY(CPON)]

Gene Names: Npy

Research Areas: Neuroscience

Organism: Mus musculus (Mouse)

AA Sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

Source: Yeast

Tag Info: N-terminal hFc-tagged

Expression Region: 29-64aa

Sequence Info: Partial

MW: 30.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

Reference: "Behavioral characterization of neuropeptide Y knockout mice." Bannon A.W., Seda J., Carmouche M., Francis J.M., Norman M.H., Karbon B., McCaleb M.L. Brain Res 868:79-87(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P57774

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose