Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C), partial (Active) | CSB-MP853495HU1

(No reviews yet) Write a Review
SKU:
CSB-MP853495HU1
Availability:
3 to 7 Working Days
  • Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£167.20 - £271.20

Description

Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) ,partial (Active) | CSB-MP853495HU1 | Cusabio

Protein Description: Partial

Alternative Name (s) :

Gene Names: TNFRSF13C

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-Flag-tagged

Expression Region: 7-71aa

Sequence Info: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B) , the EC50 is 0.2699-0.5613 ng/ml.

MW: 36.4

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q96RJ3

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose