Cusabio Active Proteins
Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C), partial (Active) | CSB-MP853495HU1
- SKU:
- CSB-MP853495HU1
- Availability:
- 3 to 7 Working Days
Description
Recombinant Human Tumor necrosis factor receptor superfamily member 13C (TNFRSF13C) ,partial (Active) | CSB-MP853495HU1 | Cusabio
Protein Description: Partial
Alternative Name (s) :
Gene Names: TNFRSF13C
Research Areas: Immunology
Species: Homo sapiens (Human)
Source: Mammalian cell
Tag Info: C-terminal hFc-Flag-tagged
Expression Region: 7-71aa
Sequence Info: SLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAA
Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized TNFSF13B (CSB-MP897523HU1) at 2 μg/ml can bind TNFRSF13C, the EC50 is 9.943-15.72 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized human TNFRSF13C at 2 μg/ml can bind Biotinylated human TNFSF13B (CSB-MP897523HU1-B) , the EC50 is 0.2699-0.5613 ng/ml.
MW: 36.4
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Relevance:
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q96RJ3
Uniprot Entry Name:
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A