Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40), partial (Active) | CSB-MP004936HU1

Recombinant Human Tumor necrosis factor receptor superfamily member 5 (CD40) ,partial (Active) | CSB-MP004936HU1 | Cusabio

Protein Description: Partial

Alternative Name (s) :

Gene Names: CD40

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 21-193aa

Sequence Info: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR

Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L (CSB-MP004937HU3) , the EC50 is 3.112-3.858 ng/ml.②Human CD40 protein hFc tag (CSB-MP004936HU1) captured on COOH chip can bind Human CD40L protein hFc and Flag tag (CSB-MP004937HU3) with an affinity constant of 2.06 nM as detected by LSPR Assay.

MW: 48

Purity: Greater than 92% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance:

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25942

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A