null

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17), partial (Active) | CSB-MP023974HU1

(No reviews yet) Write a Review
SKU:
CSB-MP023974HU1
Availability:
3 to 7 Working Days
  • Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) ,partial (Active)
  • Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€241.00 - €339.00
Frequently bought together:

Description

Recombinant Human Tumor necrosis factor receptor superfamily member 17 (TNFRSF17) ,partial (Active) | CSB-MP023974HU1 | Cusabio

Protein Description: Partial

Alternative Name (s) : B-cell maturation protein (CD_antigen: CD269)

Gene Names: Tnfrsf17

Research Areas: Cancer

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 1-54aa

Sequence Info: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.

MW: 34.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q02223

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose